ID HE600703; SV 1; linear; genomic RNA; STD; VRL; 777 BP. XX AC HE600703; XX DT 04-OCT-2011 (Rel. 110, Created) DT 05-AUG-2023 (Rel. 144, Last updated, Version 2) XX DE Tomato spotted wilt virus NP gene for nucleocapsid protein, segment S, DE genomic RNA, isolate P330 XX KW . XX OS Orthotospovirus tomatomaculae OC Viruses; Riboviria; Orthornavirae; Negarnaviricota; Polyploviricotina; OC Ellioviricetes; Bunyavirales; Tospoviridae; Orthotospovirus. XX RN [1] RP 1-777 RA Moury B.; RT ; RL Submitted (29-SEP-2011) to the INSDC. RL Station de Pathologie Vegetale, Institut National de Recherche Agronomiq, RL Domaine St Maurice, BP94, F-84143 Montfavet Cedex, FRANCE. XX RN [2] RA Aguilar J.M.; RT "Pepper resistance-breaking isolate of Tomato spotted wilt virus"; RL Unpublished. XX DR MD5; 8087e038bdc52b638fe6a2b6253f1ef2. XX FH Key Location/Qualifiers FH FT source 1..777 FT /organism="Orthotospovirus tomatomaculae" FT /segment="S" FT /isolate="P330" FT /mol_type="genomic RNA" FT /country="Spain" FT /isolation_source="Capsicum annuum" FT /db_xref="taxon:3052585" FT CDS 1..777 FT /transl_table=1 FT /gene="NP" FT /product="nucleocapsid protein" FT /db_xref="GOA:Q88910" FT /db_xref="InterPro:IPR002517" FT /db_xref="UniProtKB/TrEMBL:Q88910" FT /protein_id="CCD61122.1" FT /translation="MSKVKLTKESIVALLTQGKDLEFEEDQNLVAFNFKTFCLENLDQI FT KKMSVISCLTFLKNRQSIMKVIKQSDFTFGKITIKKTSDRIGATDMTFRRLDSLIRVRL FT VEETGNSENLNTIKSKIASHPLIQAYGLPLDDAKSVRLAIMLGGSLPLIASVDSFEMIS FT VVLAIYQDAKYKDLGIDPKKYDTREALGKVCTVLKSKAFEMNEDQVKKGKEYAAILSSS FT NPNAKGSIAMEHYSETLNKFYEMFGVKKQAKLAELA" XX SQ Sequence 777 BP; 250 A; 133 C; 179 G; 215 T; 0 other; atgtctaagg ttaagctcac taaggaaagc attgttgctt tgttgacaca aggcaaagac 60 cttgagtttg aggaagatca gaatctggta gcattcaact tcaagacttt ttgtctggaa 120 aaccttgacc agatcaaaaa gatgagcgtt atttcatgtc tgacattcct gaagaatcgt 180 cagagcataa tgaaggttat taagcagagt gattttactt ttggtaaaat taccataaag 240 aaaacttcag acaggattgg agccactgac atgaccttca gaaggcttga cagcttgatc 300 agggtcaggc ttgttgagga aactgggaat tctgagaatc tcaatactat caaatctaag 360 attgcttccc accctttgat tcaagcctat ggattacctc ttgatgatgc aaagtctgtg 420 aggcttgcca taatgctggg aggtagctta cctcttattg cttcagttga tagctttgag 480 atgatcagtg ttgtcttggc tatatatcag gatgcaaaat acaaggacct cgggatcgac 540 ccaaagaagt atgacaccag ggaagcttta ggaaaagttt gcactgtgct gaaaagcaaa 600 gcatttgaga tgaatgaaga tcaggtgaag aaggggaaag agtatgctgc tatacttagc 660 tccagcaatc ctaatgctaa aggaagtatt gctatggaac attacagtga aactcttaac 720 aagttctatg agatgtttgg ggttaaaaaa caggcaaaac tcgcagaact tgcttaa 777 //