ID FR693253; SV 1; linear; genomic RNA; STD; VRL; 774 BP. XX AC FR693253; XX DT 22-SEP-2010 (Rel. 106, Created) DT 05-AUG-2023 (Rel. 144, Last updated, Version 3) XX DE Tomato spotted wilt virus segment S partial NP gene for nucleocapsid, DE isolate RCSANCHEZ, genomic RNA XX KW . XX OS Orthotospovirus tomatomaculae OC Viruses; Riboviria; Orthornavirae; Negarnaviricota; Polyploviricotina; OC Ellioviricetes; Bunyavirales; Tospoviridae; Orthotospovirus. XX RN [1] RP 1-774 RA Moury B.; RT ; RL Submitted (21-SEP-2010) to the INSDC. RL Moury B., Institut National de Recherche Agronomiq, Station de Pathologie RL Vegetale, Domaine St Maurice, BP94, F-84143 Montfavet Cedex, FRANCE. XX RN [2] RA Tentchev D., Verdin E., Marchal C., Jacquet M., Aguilar J.M., Moury B.; RT "Evolution and structure of Tomato spotted wilt virus populations: evidence RT of extensive reassortment and insights into emergence processes"; RL J. Gen. Virol. 92(Pt 4):961-973(2011). XX DR MD5; 7d3bd33335bda20a8cb45e68984262cc. XX FH Key Location/Qualifiers FH FT source 1..774 FT /organism="Orthotospovirus tomatomaculae" FT /segment="S" FT /isolate="RCSANCHEZ" FT /mol_type="genomic RNA" FT /country="USA" FT /collection_date="1995" FT /db_xref="taxon:3052585" FT CDS 1..>774 FT /gene="NP" FT /product="nucleocapsid" FT /db_xref="GOA:E1Y6K8" FT /db_xref="InterPro:IPR002517" FT /db_xref="UniProtKB/TrEMBL:E1Y6K8" FT /protein_id="CBX24339.1" FT /translation="MSKVKLTKESIVALLTQGKDLEFEEDQNLVAFNFKTFCLGNLDQI FT KKMSIISCLTFLKNRQSIMKVIKQSDFTFGKITIKKTSDRIGATDMTFRRLDSLIRVRL FT VEETGNSENLNTIKSKIASHPLIQAYGLPLDDAKSVRLAIMLGGSLPLIASVDSFEMIS FT VVLAIYQDAKYKDLGIDPKKYDTREALGKVCTVLKSKAFEMTEDQVKKGKEYAAILSSS FT NPNAKGSVAMEHYSETLNKFYEMFGVKKQAKLTELA" XX SQ Sequence 774 BP; 251 A; 134 C; 175 G; 214 T; 0 other; atgtctaagg ttaagctcac taaggaaagc attgttgctt tgttgacaca aggcaaagac 60 cttgagtttg aggaagatca gaatctggta gcattcaact tcaagacttt ttgtctggga 120 aaccttgacc agatcaaaaa gatgagcatt atttcatgtc tgacattcct gaagaatcgt 180 cagagcataa tgaaggttat caagcaaagt gattttactt ttggtaaaat taccataaag 240 aaaacttcag acaggattgg agccactgac atgaccttca gaaggcttga tagcttgatc 300 agggtcaggc ttgttgagga aactgggaat tctgagaatc tcaatactat caaatctaag 360 attgcttccc accctttgat tcaagcctat ggattacctc ttgacgatgc aaagtctgtg 420 aggcttgcca taatgctagg aggtagctta cctcttattg cttcagttga tagctttgag 480 atgatcagtg ttgtcttggc tatatatcag gatgcaaaat acaaagacct cgggatcgac 540 ccaaagaagt atgacaccag ggaagcctta gggaaagttt gcactgtgct gaaaagcaaa 600 gcatttgaaa tgactgaaga tcaggtgaag aaggggaaag agtatgctgc tatacttagt 660 tctagcaatc ctaatgctaa aggaagtgtt gctatggaac attacagtga aactcttaac 720 aagttctatg aaatgtttgg ggttaaaaaa caggcaaaac tcacagaact tgct 774 //