ID FR693062; SV 1; linear; genomic RNA; STD; VRL; 774 BP. XX AC FR693062; XX DT 22-SEP-2010 (Rel. 106, Created) DT 05-AUG-2023 (Rel. 144, Last updated, Version 3) XX DE Tomato spotted wilt virus segment S partial NP gene for nucleocapsid, DE isolate LYE89, genomic RNA XX KW . XX OS Orthotospovirus tomatomaculae OC Viruses; Riboviria; Orthornavirae; Negarnaviricota; Polyploviricotina; OC Ellioviricetes; Bunyavirales; Tospoviridae; Orthotospovirus. XX RN [1] RP 1-774 RA Moury B.; RT ; RL Submitted (21-SEP-2010) to the INSDC. RL Moury B., Institut National de Recherche Agronomiq, Station de Pathologie RL Vegetale, Domaine St Maurice, BP94, F-84143 Montfavet Cedex, FRANCE. XX RN [2] RA Tentchev D., Verdin E., Marchal C., Jacquet M., Aguilar J.M., Moury B.; RT "Evolution and structure of Tomato spotted wilt virus populations: evidence RT of extensive reassortment and insights into emergence processes"; RL J. Gen. Virol. 92(Pt 4):961-973(2011). XX DR MD5; 1bb25f09915a39fc67afe3109a4da6bc. XX FH Key Location/Qualifiers FH FT source 1..774 FT /organism="Orthotospovirus tomatomaculae" FT /segment="S" FT /isolate="LYE89" FT /mol_type="genomic RNA" FT /country="France" FT /isolation_source="Solanum lycopersicum" FT /collection_date="1993" FT /db_xref="taxon:3052585" FT CDS 1..>774 FT /gene="NP" FT /product="nucleocapsid" FT /db_xref="GOA:E1Y617" FT /db_xref="InterPro:IPR002517" FT /db_xref="UniProtKB/TrEMBL:E1Y617" FT /protein_id="CBX24148.1" FT /translation="MSKVKLTKESIVALLTQGKDLEFEEDQNLVAFNFKTFCLENLDQI FT KKMSVISCLTFLKNRQSIMKVIKQSDFTFGKITIKKTSDRIGATDMTFRRLDSLIRVRL FT VEETGNSENLNTIKSKIASHPLIQAYGLPLDDAKSVRLAIMLGGSLPLIASVDSFEMIS FT VVLAIYQDAKYKDLGIDPKKYDTREALGKVCTVLKSKAFEMNEDQVKKGKEYAAILSSS FT NPNAKGSIAMEHYSETLNKFYEMFGVKKQAKLAELA" XX SQ Sequence 774 BP; 256 A; 135 C; 172 G; 211 T; 0 other; atgtctaagg ttaagctcac taaggaaagc attgttgctt tgttgacaca aggcaaagac 60 cttgagtttg aggaagatca gaatctggta gcattcaact tcaagacttt ttgtctggaa 120 aacctcgacc agatcaagaa gatgagcgtt atttcatgtc tgacattcct gaagaatcgt 180 cagagtataa tgaaggttat taaacaaagt gattttactt ttggtaaaat taccataaag 240 aaaacttcag acaggattgg agccactgac atgaccttca gaaggcttga tagcttgatc 300 agggtcaggc ttgtagagga aactgggaat tctgagaatc tcaatactat caaatctaag 360 attgcttccc accctttgat tcaagcctat ggattacctc ttgatgatgc aaagtctgtg 420 aggcttgcca taatgctggg aggtagctta cctcttattg cttcagtcga tagctttgag 480 atgatcagtg ttgtcttggc tatatatcag gatgcaaaat acaaagacct cgggattgac 540 ccaaagaagt atgacaccag agaagcctta ggaaaagttt gcactgtgct gaaaagcaaa 600 gcatttgaaa tgaatgaaga tcaggtgaag aaaggaaaag agtatgctgc tatactcagc 660 tccagcaatc ctaatgctaa aggaagtatt gctatggaac attacagtga aactcttaac 720 aagttctatg aaatgttcgg ggttaaaaaa caggcaaaac tcgcagaact tgct 774 //