ID FR693053; SV 1; linear; genomic RNA; STD; VRL; 774 BP. XX AC FR693053; XX DT 22-SEP-2010 (Rel. 106, Created) DT 05-AUG-2023 (Rel. 144, Last updated, Version 3) XX DE Tomato spotted wilt virus segment S partial NP gene for nucleocapsid, DE isolate France81, genomic RNA XX KW . XX OS Orthotospovirus tomatomaculae OC Viruses; Riboviria; Orthornavirae; Negarnaviricota; Polyploviricotina; OC Ellioviricetes; Bunyavirales; Tospoviridae; Orthotospovirus. XX RN [1] RP 1-774 RA Moury B.; RT ; RL Submitted (21-SEP-2010) to the INSDC. RL Moury B., Institut National de Recherche Agronomiq, Station de Pathologie RL Vegetale, Domaine St Maurice, BP94, F-84143 Montfavet Cedex, FRANCE. XX RN [2] RA Tentchev D., Verdin E., Marchal C., Jacquet M., Aguilar J.M., Moury B.; RT "Evolution and structure of Tomato spotted wilt virus populations: evidence RT of extensive reassortment and insights into emergence processes"; RL J. Gen. Virol. 92(Pt 4):961-973(2011). XX DR MD5; 7b5b961dfa02f3c6adbd2a4a89a46a41. XX FH Key Location/Qualifiers FH FT source 1..774 FT /organism="Orthotospovirus tomatomaculae" FT /segment="S" FT /isolate="France81" FT /mol_type="genomic RNA" FT /country="France" FT /isolation_source="Capsicum" FT /collection_date="2008" FT /db_xref="taxon:3052585" FT CDS 1..>774 FT /gene="NP" FT /product="nucleocapsid" FT /db_xref="GOA:E1Y608" FT /db_xref="InterPro:IPR002517" FT /db_xref="UniProtKB/TrEMBL:E1Y608" FT /protein_id="CBX24139.1" FT /translation="MSKVKLTKENIVALLTQSKDLEFEEDQNLVAFNFKTFCLENLDQI FT KKMSIISCLTFLKNRQSIMKVIKQSDFTFGKITIKKTSDRIGATDMTFRRLDSLIRVRL FT VEETGNSENLNTIKSKIASHPLIQAYGLPLDDAKSVRLAIMLGGSLPLIASVDSFEMIS FT VVLAIYQDAKYKDLGIDPKKYDTREALGKVCTVLKSKAFEMNEDQVKKGKEYAAILSSS FT NPNAKGSIAMEHYSETLNKFYEMFGVKKQAKLAELA" XX SQ Sequence 774 BP; 258 A; 132 C; 169 G; 215 T; 0 other; atgtctaagg tcaagctcac taaggaaaac attgttgctt tgttgacaca aagcaaagat 60 cttgaatttg aggaagatca gaatctggta gcattcaact tcaagacttt ttgtctggaa 120 aaccttgacc agatcaagaa gatgagcatt atttcatgtc tgacattcct gaagaatcgt 180 cagagtataa tgaaggttat taagcaaagt gattttactt ttggtaaaat taccataaag 240 aaaacttcag acaggattgg agccaccgac atgaccttca gaaggcttga tagcttgatc 300 agggtcaggc ttgtcgagga aactgggaat tctgagaatc tcaatactat caaatctaag 360 attgcttctc accctctgat tcaagcctat ggattacctc ttgatgatgc aaagtctgtg 420 aggcttgcca taatgctggg aggtagctta cctcttattg cttcagttga tagctttgaa 480 atgatcagtg ttgtcttggc tatatatcag gatgcaaaat acaaagacct cgggattgat 540 ccaaagaagt atgacaccag ggaagcccta ggaaaagttt gcactgtgct aaaaagcaaa 600 gcatttgaaa tgaatgaaga tcaggtgaag aaagggaaag agtatgctgc tatacttagc 660 tccagcaatc ctaatgctaa aggaagtatt gctatggaac attacagtga aactcttaac 720 aagttctatg aaatgtttgg ggttaaaaaa caggcaaaac ttgcagaact tgct 774 //