ID FN554696; SV 1; linear; genomic RNA; STD; VRL; 651 BP. XX AC FN554696; XX DT 29-SEP-2009 (Rel. 102, Created) DT 29-SEP-2009 (Rel. 102, Last updated, Version 1) XX DE Cucumber mosaic virus partial CP gene for coat protein, genomic RNA, DE isolate 25Huahine XX KW . XX OS Cucumber mosaic virus (cucumber mosaic cucumovirus) OC Viruses; Riboviria; Bromoviridae; Cucumovirus. XX RN [1] RP 1-651 RA Grisoni M.; RT ; RL Submitted (23-SEP-2009) to the INSDC. RL Grisoni M., Cirad, UMR 53-PVBMT, 97410, 97410 Saint Pierre, REUNION. XX RN [2] RA Farreyrol K., Grisoni M., Pearson M., Richard A., Cohen D., Beck D.; RT "Genetic diversity of Cucumber mosaic virus infecting vanilla in French RT Polynesia and Reunion Island"; RL Unpublished. XX DR MD5; 686f26ae2a149d7fe3e630afc0091a96. XX FH Key Location/Qualifiers FH FT source 1..651 FT /organism="Cucumber mosaic virus" FT /host="Vanilla tahitensis" FT /isolate="25Huahine" FT /mol_type="genomic RNA" FT /country="French Polynesia" FT /collected_by="M. Grisoni" FT /collection_date="Jul-2002" FT /db_xref="taxon:12305" FT CDS <1..>651 FT /codon_start=1 FT /gene="CP" FT /product="coat protein" FT /db_xref="GOA:C8ZLN9" FT /db_xref="InterPro:IPR000247" FT /db_xref="InterPro:IPR023800" FT /db_xref="InterPro:IPR037137" FT /db_xref="UniProtKB/TrEMBL:C8ZLN9" FT /protein_id="CBG22877.1" FT /translation="DKSESTSAGRSRRRRPRRGSRSAPSSADATFRVLSQQLSRLNKTL FT AAGRPTINHPTFVGSERCKPGYTFTSITLKPPKIDRGSYYGKRLLLPDSVTEFDKKLVS FT RIQIRVNPLPKFDSTVWVTVRKVPASSDLSVAAISAMFADGASPVLVYQYAASGVQANN FT KLLYDLSAMRADIGDMRKYAVLVYSKDDALETDELVLHVDIEHQRIPTSGVLPV" XX SQ Sequence 651 BP; 146 A; 172 C; 156 G; 177 T; 0 other; gacaaatctg aatcaaccag tgctggtcgt agccgtcgac gtcgtccgcg tcgtggttcc 60 cgctccgctc cctcctccgc ggatgctacc tttagagtct tgtcgcagca gctttcgcga 120 cttaataaga cgttagcagc tggtcgtcca actattaacc acccaacctt tgtgggtagt 180 gagcgttgta aacctggata cacgttcaca tctatcaccc tgaagccacc gaaaatagac 240 cgtgggtctt attatggtaa aaggttgttg ctacctgatt cagtcacaga gttcgataag 300 aagcttgttt cgcgcattca aattcgagtt aatcctttgc cgaaatttga ttctaccgtg 360 tgggtgacag tccggaaagt tcctgcctcc tcggacttat ccgttgccgc tatctctgct 420 atgtttgcgg acggagcctc accggtactg gtttatcagt atgccgcatc tggtgtccaa 480 gctaacaaca aactgttgta tgatctttca gcgatgcgcg ctgatatcgg tgacatgaga 540 aagtacgccg tcctcgtgta ttcaaaagac gatgcgctcg agacggacga gttggtactt 600 catgtcgaca ttgagcacca acgcattccc acatcagggg tgctcccagt t 651 //