ID FN554685; SV 1; linear; genomic RNA; STD; VRL; 651 BP. XX AC FN554685; XX DT 29-SEP-2009 (Rel. 102, Created) DT 29-SEP-2009 (Rel. 102, Last updated, Version 1) XX DE Cucumber mosaic virus partial CP gene for coat protein, genomic RNA, DE isolate 14Raiatea XX KW . XX OS Cucumber mosaic virus (cucumber mosaic cucumovirus) OC Viruses; Riboviria; Bromoviridae; Cucumovirus. XX RN [1] RP 1-651 RA Grisoni M.; RT ; RL Submitted (23-SEP-2009) to the INSDC. RL Grisoni M., Cirad, UMR 53-PVBMT, 97410, 97410 Saint Pierre, REUNION. XX RN [2] RA Farreyrol K., Grisoni M., Pearson M., Richard A., Cohen D., Beck D.; RT "Genetic diversity of Cucumber mosaic virus infecting vanilla in French RT Polynesia and Reunion Island"; RL Unpublished. XX DR MD5; 1971fccaa5e07bdec7c71815d41bad6b. XX FH Key Location/Qualifiers FH FT source 1..651 FT /organism="Cucumber mosaic virus" FT /host="Vanilla tahitensis" FT /isolate="14Raiatea" FT /mol_type="genomic RNA" FT /country="French Polynesia" FT /collected_by="M. Grisoni" FT /collection_date="Jul-2002" FT /db_xref="taxon:12305" FT CDS <1..>651 FT /codon_start=1 FT /gene="CP" FT /product="coat protein" FT /db_xref="GOA:C8ZLM8" FT /db_xref="InterPro:IPR000247" FT /db_xref="InterPro:IPR023800" FT /db_xref="InterPro:IPR037137" FT /db_xref="UniProtKB/TrEMBL:C8ZLM8" FT /protein_id="CBG22866.1" FT /translation="DKSESTSAGRNRRRRPRRGSRSASSSADATFRVLSQQLSRLNKTL FT AAGRPTINHPTFVGSERCKPGYTFTSITLKPPKIDRGSYYGKRLLLPDSVTEFDKKLVS FT RIQIRVNPLPKFDSTVWVTVRKVPASSDLSVAAISAMFADGASPVLVYQYAASGVQANN FT KLLYDLSAMRADIGDMRKYAVLVYSKDDALETDELVLHVDIEHQRIPTSGVLPV" XX SQ Sequence 651 BP; 150 A; 175 C; 152 G; 174 T; 0 other; gacaaatctg aatcaaccag tgctggtcgt aaccgtcgac gtcgtccgcg tcgcggttcc 60 cgctccgctt cctcctccgc ggatgctaca tttagagtcc tgtcgcaaca actttcgcga 120 ctcaataaga cgttagcagc tggtcgtcct actattaacc acccaacctt tgtgggtagt 180 gagcgttgta aacctggata cacgttcaca tctattaccc taaaaccacc gaaaatagac 240 cgagggtctt attatggtaa aaggttgtta cttcctgatt cagtcactga gttcgataag 300 aagcttgttt cgcgcattca aattcgagtt aatcctttgc cgaaatttga ttctactgtg 360 tgggtgacgg tccgtaaagt tcctgcctcc tcggacctgt ccgtcgccgc catctctgct 420 atgttcgcgg acggagcctc accagtactg gtctatcagt atgccgcatc gggagtccaa 480 gccaacaata aattgttgta tgatctttcg gcgatgcgcg ctgatattgg cgacatgaga 540 aagtacgccg tgctcgtgta ttcaaaagac gatgcactcg agacggatga gctagtactt 600 catgtcgaca tcgagcacca acgcattccc acgtctgggg tgctcccagt t 651 //