ID FM164726; SV 1; circular; genomic DNA; STD; VRL; 2386 BP. XX AC FM164726; XX DT 02-JUN-2009 (Rel. 101, Created) DT 02-JUN-2009 (Rel. 101, Last updated, Version 1) XX DE Okra leaf curl virus-[Cameroon] complete sequence, isolate LY11 XX KW . XX OS Okra leaf curl virus-[Cameroon] OC Viruses; Geminiviridae; Begomovirus; unclassified Begomovirus. XX RN [1] RP 1-2386 RA Leke W.N.; RT ; RL Submitted (01-JUN-2008) to the INSDC. RL Leke W.N., Dept of Plant Biol and Forest Genetics, Swedish Univ of RL Agricultural Sciences, Box 7080, SE-750 07, Uppsala, SWEDEN. XX RN [2] RA Leke W.N., Besem E.N., Njualem D.K., Titanji V.P., Legg J.P., Fondong V.N., RA Ngeve J.M., Zok S., Brown J.K., Kvarnheden A.; RT "First report of recombination between Cotton leaf curl Gezira virus RT (CLCuGV)and Okra yellow crinkle virus (OYCrV) and its associated DNA beta RT satellite"; RL Unpublished. XX DR MD5; 4e21d9e05e66c2cb314829d16e6f5589. DR EuropePMC; PMC2839976; 20178575. XX FH Key Location/Qualifiers FH FT source 1..2386 FT /organism="Okra leaf curl virus-[Cameroon]" FT /host="Albelmoschus esculentus" FT /isolate="LY11" FT /mol_type="genomic DNA" FT /country="Cameroon:Lysoka" FT /db_xref="taxon:627503" FT CDS 182..457 FT /gene="V1" FT /product="coat protein" FT /db_xref="GOA:C5J4Q3" FT /db_xref="InterPro:IPR002511" FT /db_xref="UniProtKB/TrEMBL:C5J4Q3" FT /protein_id="CAQ63435.1" FT /translation="MWDPLVNEFPESVHGFRCMLAIKYLQALEDTYEPNTLGSDLIRDL FT ISVIRAKNYVEATRRYNYSTPHMVIAHKILDRYLICLIMSPALQRL" FT CDS 421..678 FT /gene="V2" FT /product="pre-coat protein" FT /db_xref="GOA:C5J4Q4" FT /db_xref="InterPro:IPR000263" FT /db_xref="InterPro:IPR000650" FT /db_xref="UniProtKB/TrEMBL:C5J4Q4" FT /protein_id="CAQ63436.1" FT /translation="MFDNEPSTATVMNDKRDRYQVLKRFQATVTGGPSGCREAAIVRRF FT FKINHHVTYNHQEAAKYENHTENALLLYMACTHASKPCVC" FT CDS complement(718..1119) FT /gene="C3" FT /product="replication enhancer protein" FT /db_xref="GOA:C5J4Q5" FT /db_xref="InterPro:IPR000657" FT /db_xref="UniProtKB/TrEMBL:C5J4Q5" FT /protein_id="CAQ63437.1" FT /translation="MDSRTGELITAHQTENGVLIWTINNPLYFKTIKEIPLTHGNQTMV FT EMQIRFNYNLRKELGIHKCFMNFRVWTISRPPTGLFLNVFRKQIMKYLYRLGVISINNV FT IRAVNHVLYDVLQTTVASEFTHNIQIKLY" FT CDS complement(863..1267) FT /gene="transcriptional activator protein" FT /product="C2" FT /db_xref="GOA:C5J4Q6" FT /db_xref="InterPro:IPR000942" FT /db_xref="UniProtKB/TrEMBL:C5J4Q6" FT /protein_id="CAQ63438.1" FT /translation="MRPSSPSHIRCTQVPIKVQHREAKKRAIRRRRIDIPCGCTVYVAF FT MCRDNGFTHRGTHHCASDREWRTYLDNQQSPIFQNHQGDSSDARESNNGRDADKIQLQP FT QEGIGDSQMFHELQGLDDLTPSDWSFLKRI" FT CDS complement(1167..2255) FT /gene="C1" FT /product="replication associated protein" FT /db_xref="GOA:C5J4Q7" FT /db_xref="InterPro:IPR001191" FT /db_xref="InterPro:IPR001301" FT /db_xref="InterPro:IPR022690" FT /db_xref="InterPro:IPR022692" FT /db_xref="UniProtKB/TrEMBL:C5J4Q7" FT /protein_id="CAQ63439.1" FT /translation="MAPNKRFQIYAKNFFLTFPKCSLSKEEALEQLQQISTASNKKYIK FT ICRELHEDGQPHLHVLLQFEGKFKCQNQRLFDLVSPNRSAHFHPNIQGAKSSSDVKSYI FT DKDGDTLEWGEFQIDGRSARGGQQTANDAYAAALNAGSKTEALRVIRELAPKDFVLQYH FT NLINNLDRIFQEPPAPYVSPFLSSSFDQVPEELEEWAAENVVEAAARPGRPISIVIEGE FT SRTGKTVWARSLGPHNYLCGHLDLSPKVFSNDAWYNVIDDVDPHYLKHFKEFMGAQKDW FT QSNTKYGKPVQIKGGIPTIFLCNPGPNSSYKDYLDEEKNAHLKSWALKNATFITLSYPL FT YSGTNQSPASGGQEESNQETQD" FT CDS complement(1805..2098) FT /gene="C4" FT /product="hypothetical protein" FT /db_xref="InterPro:IPR002488" FT /db_xref="UniProtKB/TrEMBL:C5J4Q8" FT /protein_id="CAQ63440.1" FT /translation="MANLICMCFSNSKGSSSAKIRDYSTWSPQIGQHISIQTFRELSPA FT PTSSPTSTRMETHSNGENSRSTEDLPEEANRQPMTLTPQRLTQGVRQRLLGL" XX SQ Sequence 2386 BP; 615 A; 509 C; 525 G; 737 T; 0 other; accggtgggc gcgaaaaaaa aaagtggacc ccgccccacg tgaacatgtc gcgcgagtgc 60 tgaacatgtc gcgcgcgtgc tgaacatgac gcgcgatgct gtccaatcag aacgcgcgct 120 ctacgcatta taatttgaaa tttgaaatat atacttgctc cctaagttgt ccgccataac 180 tatgtgggat ccgttagtga acgagtttcc cgaatctgtg catgggtttc gttgtatgct 240 tgcaataaaa tatctgcagg ctttagagga tacgtacgag cccaacacgt tggggtctga 300 tttaattaga gatttaatat ctgtgattag agcgaagaat tatgtcgaag cgaccaggag 360 atataattat tccacgcccc atatggtaat agcccacaag attttggaca ggtatttaat 420 atgtttgata atgagcccag cactgcaacg gttatgaacg acaagcgtga tcgatatcag 480 gttttaaaga ggtttcaagc aactgtcact ggaggaccgt ctggttgcag agaggctgct 540 attgttaggc gttttttcaa gataaaccat catgtcactt acaatcatca ggaagctgcc 600 aaatatgaga atcatacgga gaatgcttta ctactgtata tggcctgtac tcatgcgtca 660 aagccctgtg tatgctagtc ttaaaatacg aatgtatttc tacgattcag tttcgaatta 720 atataatttt atttgaatat tgtgcgtgaa ttcacttgcc actgttgttt gcaatacatc 780 gtacaaaaca tgattaactg ctctaattac attgttaatt gaaattacac ctaatctata 840 caaatatttc ataatctgtt tcctaaatac gtttaagaaa agaccagtcg gagggcgtga 900 gatcgtccag accctgaagt tcatgaaaca tttgtgaatc cccaattcct tcctgaggtt 960 gtagttgaat cttatctgca tctctaccat tgtttgattc ccgtgcgtca gaggaatctc 1020 cttgatggtt ttgaaatata ggggattgtt gattgtccag ataagtacgc cattctctgt 1080 ctgatgcgca gtgatgagtt cccctgtgcg tgaatccatt gtctctgcac atgaaggcta 1140 cgtatactgt gcaaccacaa gggatgtcaa tcctgcgtct cctgattgct ctcttcttgg 1200 cctcccgatg ctggactttg attggtacct gagtacagcg gatatgagag ggtgatgaag 1260 gtcgcattct ttaatgccca ggatttgaga tgtgcgttct tctcctcgtc taaatagtct 1320 ttatatgagg aatttggacc tggattgcag aggaagattg ttgggatgcc gcctttaatt 1380 tgaaccggtt tcccgtattt tgtgttgctt tgccagtcct tttgtgcacc catgaactcc 1440 ttaaagtgtt tcagataatg cgggtcaaca tcatctatga cgttatacca tgcgtcatta 1500 ctgaacacct ttgggctcag atcaagatgg ccgcacagat aattatgagg cccaagactt 1560 ctggcccata cggtcttccc tgttctgctt tctccttcaa tcactatact aatcggtcta 1620 cctggccgcg cagcggcctc aacgacgttc tccgccgccc attcttcaag ttcttctgga 1680 acttggtcga acgaagaaga caaaaaagga gaaacataag gagctggagg ctcctgaaaa 1740 atcctatcta aattattaat taaattatga tattgtaaaa caaaatcttt gggagctaac 1800 tcccttataa ccctaagagc ctctgtctta ctccctgcgt taagcgctgc ggcgtaagcg 1860 tcattggctg tctgttggcc tcctctggca gatcttccgt cgatctggaa ttctccccat 1920 tcgagtgtgt ctccatcctt gtcgatgtag gacttgacgt cggagctgga cttagctccc 1980 tgaatgtttg gatggaaatg tgctgaccta tttggggaga ccaggtcgaa tagtctctga 2040 ttttggcact tgaacttccc ttcgaattgg agaagcacat gcagatgagg ttggccatcc 2100 tcgtgaagct ctctgcaaat cttgatgtat tttttgtttg atgctgtact tatttgctgg 2160 agttgctcta gggcttcctc tttgcttaga gaacattttg ggaaagttag gaaaaaattc 2220 tttgcatata tttggaatct cttgttagga gccattgact tggtcaatcg gtactcagat 2280 gcttctctct agtatatcgg tactcaatat atagtgagta ccaaatggca ttttggtaaa 2340 aatcccaata attttgaacc ccaatagcgc ccaccgttct aatatt 2386 //