ID FJ851291; SV 1; linear; genomic RNA; STD; VRL; 336 BP. XX AC FJ851291; XX DT 13-APR-2009 (Rel. 100, Created) DT 13-APR-2009 (Rel. 100, Last updated, Version 1) XX DE Cucumber mosaic virus isolate BF_L30_2_3 2b protein gene, complete cds. XX KW . XX OS Cucumber mosaic virus (cucumber mosaic cucumovirus) OC Viruses; Riboviria; Bromoviridae; Cucumovirus. XX RN [1] RP 1-336 RA Li Y.H., Hou Y., Zhang X.T., Zhuang M.; RT "Changes of 2b protein gene of cucumber mosaic virus"; RL Unpublished. XX RN [2] RP 1-336 RA Li Y.H., Hou Y., Zhang X.T., Zhuang M.; RT ; RL Submitted (20-MAR-2009) to the INSDC. RL College of Life Science, Capital Normal University, Xisanhuan North Road RL 105, Haidian, Beijing 100048, China XX DR MD5; b07d5b3210c086c11cf0e82546e92401. XX FH Key Location/Qualifiers FH FT source 1..336 FT /organism="Cucumber mosaic virus" FT /lab_host="Nicotiana tabacum cv. Samsun NN" FT /isolate="BF_L30_2_3" FT /mol_type="genomic RNA" FT /country="China" FT /isolation_source="leaf extract" FT /collection_date="Nov-2008" FT /db_xref="taxon:12305" FT CDS 1..336 FT /codon_start=1 FT /product="2b protein" FT /db_xref="InterPro:IPR004946" FT /db_xref="UniProtKB/TrEMBL:C1KKQ1" FT /protein_id="ACO57190.1" FT /translation="MELNEGAMTNVELQLARMVEAKRQRRRSHKKNRRERCYKSPSKRA FT RSNLRLFRFLPFYQVDGSELIEMYCHVNVAELSESEAPCFTLPAEDDHDFDDTDWFAGN FT EWAEGAF" XX SQ Sequence 336 BP; 94 A; 70 C; 98 G; 74 T; 0 other; atggaattga acgaaggcgc aatgacaaac gtcgaactcc aactggcccg catggtggag 60 gcgaagagac agagacgaag gtctcacaag aagaatcgac gggaacgatg ttacaaaagt 120 cccagcaaga gagcgcgttc aaatctcaga ctgttccgct tcctaccgtt ctatcaagta 180 gatggttcgg aactgataga gatgtactgc cacgtgaacg tggcggaatt gtccgagtct 240 gaggctcctt gttttacgtt accagcggaa gatgaccatg attttgacga tacagattgg 300 ttcgctggta acgagtgggc ggaaggtgcg ttttga 336 //