ID FJ667943; SV 1; linear; genomic DNA; STD; VRL; 771 BP. XX AC FJ667943; XX DT 15-MAR-2009 (Rel. 100, Created) DT 15-MAR-2009 (Rel. 100, Last updated, Version 1) XX DE Begomovirus loofah/Khon Kaen2008/Feb2008 coat protein (CP) gene, complete DE cds. XX KW . XX OS Begomovirus loofah/Khon Kaen2008/Feb2008 OC Viruses; Geminiviridae; Begomovirus; unclassified Begomovirus. XX RN [1] RP 1-771 RA Bhunchoth A., Warin N., Chiemsombat P., Seepiban C., RA Chatchawankanphanich O., Attathom S., Gajanandana O.; RT "Nucleotide sequence of coat protein gene of begomovirus isolates from RT loofah in Thailand"; RL Unpublished. XX RN [2] RP 1-771 RA Bhunchoth A., Warin N., Chiemsombat P., Seepiban C., RA Chatchawankanphanich O., Attathom S., Gajanandana O.; RT ; RL Submitted (29-JAN-2009) to the INSDC. RL Plant Research Group, National Center for Genetic Engineering and RL Biotechnology, National Science and Technology Development Agency, RL Kasetsart University, Kamphaeng Saen Campus, Malai Man Rd., Kamphaeng Saen, RL Nakhon Pathom 73140, Thailand XX DR MD5; 549768408f8a2bafad4139065e9468c1. XX FH Key Location/Qualifiers FH FT source 1..771 FT /organism="Begomovirus loofah/Khon Kaen2008/Feb2008" FT /host="loofah" FT /isolate="Khon Kaen" FT /mol_type="genomic DNA" FT /country="Thailand" FT /collection_date="Feb-2008" FT /db_xref="taxon:613191" FT gene 1..771 FT /gene="CP" FT CDS 1..771 FT /codon_start=1 FT /gene="CP" FT /product="coat protein" FT /db_xref="GOA:C0L8J2" FT /db_xref="InterPro:IPR000263" FT /db_xref="InterPro:IPR000650" FT /db_xref="InterPro:IPR029053" FT /db_xref="UniProtKB/TrEMBL:C0L8J2" FT /protein_id="ACN62170.1" FT /translation="MSKRPADIIISTPASKVRRRLNFDSPYVSRAVVPIARVTKARAWT FT NRPMNRKPRMYRMYRSPDVPRGCEGPCKVQSFESRHDVSHIGKVMCVSDVTRGTGLTHR FT VGKRFCVKSVYVLGKIWMDENIKTKNHTNSVMFFLVRDRRPSGTPQDFGEVFNMFDNEP FT STATVKNVHRYRYQVLRKWHATVTGGTYASREQALVRKFVRVNNYVXYNQQESGKYENH FT TENALMMYMACTHASNPVYATLKIRIYFYDSVTN" XX SQ Sequence 771 BP; 216 A; 159 C; 195 G; 200 T; 1 other; atgtcgaagc gtccagcaga tatcatcatt tccacacccg cttcgaaggt acgccggcgt 60 ctgaacttcg acagccctta tgtttcccgt gcagttgtcc ccattgcccg cgtcacaaag 120 gcaagggcct ggacaaacag gcccatgaac aggaagccca gaatgtacag aatgtataga 180 agtccggacg tgcccagggg ctgtgaaggc ccttgcaagg tgcagtcgtt tgaatctagg 240 cacgatgtct cgcatattgg taaggttatg tgcgtcagtg atgttacacg gggaacggga 300 ctcacacatc gcgtaggaaa gcgattctgt gtgaaatctg tttatgtcct ggggaagata 360 tggatggatg aaaatattaa gactaaaaat cacactaata gcgtcatgtt tttccttgtt 420 cgagatcggc gcccaagtgg aactccccaa gattttgggg aggtctttaa tatgtttgat 480 aatgaaccca gcactgcgac ggtcaagaat gtgcatcgat atcgttacca ggttctgcgc 540 aaatggcatg cgactgtgac gggaggaact tacgcatcaa gggagcaagc attagttagg 600 aagtttgtta gagttaataa ttatgttgkt tataatcaac aagagtcagg caagtatgag 660 aatcatactg agaatgcatt aatgatgtat atggcctgta ctcacgcatc gaatcctgtt 720 tacgcaactt tgaaaatccg gatctatttt tatgactcag tgacgaatta a 771 //