ID FJ621524; SV 1; linear; genomic RNA; STD; VRL; 387 BP. XX AC FJ621524; XX DT 22-JUL-2009 (Rel. 101, Created) DT 09-MAR-2010 (Rel. 104, Last updated, Version 2) XX DE Melon necrotic spot virus isolate SP-9 p7A gene, complete cds; p89 gene, DE partial cds; p7B gene, complete cds; and p42 gene, partial cds. XX KW . XX OS Melon necrotic spot virus OC Viruses; Riboviria; Tombusviridae; Procedovirinae; Gammacarmovirus. XX RN [1] RP 1-387 RX DOI; 10.1111/j.1365-3059.2009.02208.x. RX AGRICOLA; IND44334960. RA Herrera-Vasquez J.A., Cordoba-Selles M.C., Cebrian M.C., Rossello J.A., RA Alfaro-Fernandez A., Jorda C.; RT "Genetic diversity of Melon necrotic spot virus and Olpidium isolates from RT different origins"; RL Plant Pathol. 59(2):240-251(2010). XX RN [2] RP 1-387 RA Herrera-Vasquez J.A., Cordoba-Selles Md.C., Cebrian Md.C., Rossello J.A., RA Jorda C.; RT ; RL Submitted (14-JAN-2009) to the INSDC. RL Ecosistemas Agroforestales, Universidad Politecnica de Valencia, Camino de RL Vera s/n, Valencia, Valencia 46022, Spain XX DR MD5; cd30c3e2d6785e9829ab03471949b1db. XX FH Key Location/Qualifiers FH FT source 1..387 FT /organism="Melon necrotic spot virus" FT /host="melon" FT /isolate="SP-9" FT /mol_type="genomic RNA" FT /country="Spain:Murcia" FT /collection_date="2008" FT /db_xref="taxon:11987" FT CDS 1..198 FT /codon_start=1 FT /product="p7A" FT /note="movement protein" FT /db_xref="GOA:Q8V993" FT /db_xref="InterPro:IPR007982" FT /db_xref="UniProtKB/TrEMBL:Q8V993" FT /protein_id="ACT53365.1" FT /translation="MDSQRTVEQTNPRGRSKERGDSGGKQKNSMGRKIANDAISESKQG FT VMGASTYIADKIKVTINFNF" FT CDS <1..22 FT /codon_start=2 FT /product="p89" FT /note="putative RNA-dependent RNA polymerase; produced by a FT readthrough of the p29 amber codon" FT /protein_id="ACT53364.1" FT /translation="WTLNEL" FT CDS 202..387 FT /codon_start=1 FT /product="p7B" FT /note="movement protein" FT /db_xref="GOA:Q8UYH9" FT /db_xref="InterPro:IPR009575" FT /db_xref="UniProtKB/TrEMBL:Q8UYH9" FT /protein_id="ACT53366.1" FT /translation="MACYRCDSSPGDYSGALLILFISFVFFYITSLSPQGNTYVHHFDN FT SSVKTQYVGISTNGDG" FT CDS 374..>387 FT /codon_start=1 FT /product="p42" FT /note="coat protein" FT /protein_id="ACT53367.1" FT /translation="MAMV" XX SQ Sequence 387 BP; 119 A; 75 C; 81 G; 112 T; 0 other; atggactctc aacgaactgt agaacaaact aatcctcgag gaagaagtaa agaacgtggt 60 gacagcgggg gaaaacagaa gaactcaatg gggcgaaaga tagccaacga tgctatctct 120 gaatcgaagc aaggtgtcat gggtgctagt acatacattg ctgataaaat taaagtgact 180 attaacttta atttctagtg tatggcttgt taccgttgtg actccagccc cggggattac 240 tctggagcat tgcttatatt atttatctca tttgttttct tttatattac ctcgcttagc 300 ccgcaaggaa atacatacgt tcatcacttc gataattctt ccgttaaaac acaatacgtt 360 ggcatctcta caaatggcga tggttaa 387 //