ID FJ531805; SV 1; linear; genomic RNA; STD; VRL; 921 BP. XX AC FJ531805; XX DT 03-JUN-2009 (Rel. 101, Created) DT 03-JUN-2009 (Rel. 101, Last updated, Version 1) XX DE Grapevine fanleaf virus isolate MF4 polyprotein gene, partial cds. XX KW . XX OS Grapevine fanleaf virus OC Viruses; Riboviria; Picornavirales; Secoviridae; Comovirinae; Nepovirus. XX RN [1] RP 1-921 RA Jawhar J., Minafra A., Boscia D., Martelli G.P.; RT "Molecular differentiation of grapevine fanleaf virus isolates causing RT yellow mosaic and infectious malformation"; RL Unpublished. XX RN [2] RP 1-921 RA Jawhar J., Minafra A., Boscia D., Martelli G.P.; RT ; RL Submitted (05-DEC-2008) to the INSDC. RL DPPMA, University of Bari, Amendola, Bari, Bari 70126, Italy XX DR MD5; 6fa6f098f4833adbf6a52d9da86fb308. XX FH Key Location/Qualifiers FH FT source 1..921 FT /organism="Grapevine fanleaf virus" FT /segment="RNA2" FT /isolate="MF4" FT /mol_type="genomic RNA" FT /country="Italy:Puglia" FT /collection_date="2008" FT /note="causes infectious malformation" FT /db_xref="taxon:12274" FT CDS 1..>921 FT /codon_start=1 FT /product="polyprotein" FT /db_xref="InterPro:IPR021081" FT /db_xref="UniProtKB/TrEMBL:C5HUS5" FT /protein_id="ACR48161.1" FT /translation="MGKFYYSSRRLACWAAGKNPHLGGSVEQWLAAIETDPSFRQTVKE FT DVQLNRERLDAIRMFSWKVGFGPIDNPENCDWHFVITGERPTQPTRPVKADEVVVVPQS FT KKVVIPSPPPPPAPYFRAVGAFAPTRSGFIRATVERLTREREELRAAALFAELPLEYPQ FT GAPLKLSLAMKFAMLKHTTWRKWYDTSDERLLEAHPGGPCLPPPPPIQRPPSFSERVRD FT FYRMKSCARAFALETSLGLNKAWVGLVDIPSTSVCCADGRTTGGQTIAQEAGPLQQRIS FT TSVAPGRAQWISERRQALRRREQANS" FT mat_peptide 1..774 FT /product="home protein" FT /note="2A" FT mat_peptide 775..>921 FT /product="movement protein" FT /note="2B" XX SQ Sequence 921 BP; 201 A; 241 C; 259 G; 220 T; 0 other; atgggcaagt tttattactc cagcaggcgt cttgcctgct gggctgctgg taagaacccc 60 catcttgggg gttctgttga acaatggctg gcggccattg aaactgatcc ctccttccgc 120 caaactgtta aggaggatgt ccagttgaac cgggagcgcc tagacgctat ccgaatgttc 180 tcctggaaag tggggttcgg gcccattgac aatcccgaaa attgtgactg gcatttcgtc 240 attactggcg agaggccaac acagccgacc cggccggtta aagccgatga ggttgtggtg 300 gtgccacaat cgaagaaggt ggtgattcca tcaccacctc ctcccccagc tccctatttt 360 agggctgttg gggcttttgc accaacccgg tccgggttta ttcgggccac tgtggaaaga 420 ctcacccggg aacgggaaga gttgagagct gcggcactct ttgccgaatt accattggag 480 tacccccaag gtgctcctct gaagttgagc ttggcgatga aattcgctat gcttaagcat 540 accacttgga ggaagtggta tgacactagt gatgagcgtc ttcttgaggc tcatcctggt 600 ggtccctgtc ttcctccccc tcccccaatc caaagacctc cctccttctc tgaaagggta 660 agggattttt acaggatgaa gtcctgtgcc agggcttttg ccttggaaac ctctctgggt 720 cttaataagg cctgggtagg tttggtggat atccccagca cttctgtgtg ctgtgcggat 780 ggaaggacta ccggtgggca aacgattgct caagaagctg gtcctttgca acagaggatc 840 agcacatcag tagcccccgg cagggcacaa tggatctccg agcgcagaca ggctctgcga 900 aggagagagc aagcaaatag c 921 //