ID FJ531802; SV 1; linear; genomic RNA; STD; VRL; 936 BP. XX AC FJ531802; XX DT 03-JUN-2009 (Rel. 101, Created) DT 03-JUN-2009 (Rel. 101, Last updated, Version 1) XX DE Grapevine fanleaf virus isolate YM10 polyprotein gene, partial cds. XX KW . XX OS Grapevine fanleaf virus OC Viruses; Riboviria; Picornavirales; Secoviridae; Comovirinae; Nepovirus. XX RN [1] RP 1-936 RA Jawhar J., Minafra A., Boscia D., Martelli G.P.; RT "Molecular differentiation of grapevine fanleaf virus isolates causing RT yellow mosaic and infectious malformation"; RL Unpublished. XX RN [2] RP 1-936 RA Jawhar J., Minafra A., Boscia D., Martelli G.P.; RT ; RL Submitted (05-DEC-2008) to the INSDC. RL DPPMA, University of Bari, Amendola, Bari, Bari 70126, Italy XX DR MD5; 838604404ba3d8a7614cfdde51e67c83. XX FH Key Location/Qualifiers FH FT source 1..936 FT /organism="Grapevine fanleaf virus" FT /segment="RNA2" FT /isolate="YM10" FT /mol_type="genomic RNA" FT /country="Italy:Puglia" FT /collection_date="2008" FT /note="causes yellow mosaic" FT /db_xref="taxon:12274" FT CDS 1..>936 FT /codon_start=1 FT /product="polyprotein" FT /db_xref="InterPro:IPR021081" FT /db_xref="UniProtKB/TrEMBL:C5HUS2" FT /protein_id="ACR48158.1" FT /translation="MGKFYYSSRRLACWAAGKNPHLGGSVEQWLAAIETDPSFRQTVKE FT DVQLNRERLDAIRMFSWRIGSGPIDNPEKCDWHFVLTGERPAQPTRPVKADEVVVVSQP FT KKVEIPSPPPPPTPYFRAVGAFAPTRSGFVRATVERLTREREESRAAALFAELPLEYPQ FT GAPLKLSMAMNFAMLKHTTWRKRNDTREERLRRAHPGGPCLPPPPPIQSPPSFQERVRE FT FCRIKSCARAFALETSLGLNRAWVGLVDIPSTSVCCADGRTTGGQTIAQEADPLQHRVS FT TSVAPGRAQWISERRQALRRREQANSLQSFI" FT mat_peptide 1..774 FT /product="home protein" FT /note="2A" FT mat_peptide 775..>936 FT /product="movement protein" FT /note="2B" XX SQ Sequence 936 BP; 210 A; 246 C; 266 G; 214 T; 0 other; atgggcaagt tttattactc cagcaggcgt cttgcctgct gggctgctgg taagaacccc 60 catcttgggg gttctgttga acaatggctg gcggccattg aaactgatcc ctccttccgc 120 caaactgtta aggaggatgt ccagttgaac cgggagcgcc tagacgctat ccgaatgttt 180 tcctggagaa ttgggtccgg gcccattgat aacccggaaa agtgtgactg gcactttgtc 240 ctcacgggcg agaggccagc acagccgacc cggccggtaa aagccgatga ggttgtggtg 300 gtgtcacaac cgaagaaggt ggagattcca tcaccacctc ctcctccaac tccctatttt 360 agggctgttg gggcctttgc accaacccgg tccgggtttg ttcgggccac tgtggaaaga 420 ctcacccggg aacgggaaga gtcgagagct gcggcactct ttgccgaatt accattggag 480 tatccccaag gagctccttt gaagttgagt atggcaatga attttgccat gcttaagcac 540 accacttgga ggaagaggaa tgacaccaga gaagagcgtc tccggagggc tcatcctggt 600 ggcccttgtc ttcctcctcc tcccccaatc caaagccctc cctcttttca agagagggtt 660 agggaatttt gcaggataaa atcctgcgcc agggcttttg ccctggaaac ctctctgggc 720 ctcaataggg cttgggtggg tttggtggac atccccagta cttctgtgtg ctgtgcggat 780 ggaaggacta ccggtgggca aacaattgct caagaagctg atcccttaca acatagggtc 840 agcacatcag tagcccccgg tagggcacaa tggatctctg agcgcaggca agccctgcgg 900 aggagagagc aagcgaatag cttgcaaagt ttcatt 936 //