ID FJ372909; SV 1; linear; genomic RNA; STD; VRL; 477 BP. XX AC FJ372909; XX DT 03-NOV-2008 (Rel. 97, Created) DT 09-JUL-2010 (Rel. 105, Last updated, Version 2) XX DE Odontoglossum ringspot virus isolate Sikkim coat protein gene, complete DE cds. XX KW . XX OS Odontoglossum ringspot virus OC Viruses; Riboviria; Virgaviridae; Tobamovirus. XX RN [1] RP 1-477 RX DOI; 10.1111/j.1439-0434.2009.01668.x. RX AGRICOLA; IND44396289. RA Rani P., Pant R.P., Jain R.K.; RT "Serological Detection of Cymbidium mosaic and Odontoglossum ringspot RT viruses in Orchids with Polyclonal Antibodies Produced Against Their RT Recombinant Coat Proteins"; RL J. Phytopathol. 158(7-8):542-545(2010). XX RN [2] RP 1-477 RA Rani P., Pant R.P., Jain R.K.; RT ; RL Submitted (08-OCT-2008) to the INSDC. RL Plant Pathology, Indian Agricultural Research Institute, New Delhi, Delhi RL 110012, India XX DR MD5; 508caa5a53ff419424c32726dda2f64b. XX FH Key Location/Qualifiers FH FT source 1..477 FT /organism="Odontoglossum ringspot virus" FT /host="Cymbidium hookerianum" FT /isolate="Sikkim" FT /mol_type="genomic RNA" FT /country="India" FT /db_xref="taxon:12238" FT CDS 1..477 FT /codon_start=1 FT /product="coat protein" FT /db_xref="GOA:B6VC72" FT /db_xref="InterPro:IPR001337" FT /db_xref="InterPro:IPR036417" FT /db_xref="UniProtKB/TrEMBL:B6VC72" FT /protein_id="ACJ04667.1" FT /translation="MSYTITDPSKLAYLSSAWADPNSLINLCTNSLGNQFQTQQARTTV FT QQQFADVWQPIPTLTSRFPAGAGYFRVYRYDPILDPLITFLMGTFDTRNRIIEVENPQN FT PTTTETLDATRRVDDATVAIRSAINNLLNELVRGTGMYNQVSFETMSGLTWTSS" XX SQ Sequence 477 BP; 140 A; 101 C; 91 G; 145 T; 0 other; atgtcttaca ctattacaga cccgtctaag ctggcttatt taagctcggc ttgggctgac 60 cccaattcac taatcaacct ttgtaccaat tctctgggta atcagttcca aacacaacaa 120 gctcgaacaa ctgttcaaca gcagtttgct gatgtttggc agccgattcc tactttgacc 180 agtaggttcc ctgcaggcgc tggttacttc agagtttatc gctatgatcc tatattagat 240 cctttaataa ctttcttaat gggtactttt gatactcgta atagaataat cgaggtagaa 300 aatccgcaga atccgacaac tacggaaaca ttagatgcaa ctcgtagagt tgatgatgca 360 actgtagcaa taagatctgc aataaataat ctattaaatg agttagttag gggaactggt 420 atgtacaatc aagtctcatt tgagacgatg tctggactta cttggacctc ttcctaa 477 //