ID FJ232922; SV 1; linear; genomic DNA; STD; VRL; 771 BP. XX AC FJ232922; XX DT 19-OCT-2008 (Rel. 97, Created) DT 19-OCT-2008 (Rel. 97, Last updated, Version 1) XX DE Squash leaf curl China virus coat protein (AV1) gene, complete cds. XX KW . XX OS Squash leaf curl China virus OC Viruses; Geminiviridae; Begomovirus. XX RN [1] RP 1-771 RA Saritha R.K., Bag T.K., Pandey S., Rai A.B., Rai M.; RT "Association of a begomovirus with mosaic of Cucurbita pepo at Varanasi"; RL Unpublished. XX RN [2] RP 1-771 RA Saritha R.K., Bag T.K., Pandey S., Rai A.B., Rai M.; RT ; RL Submitted (24-SEP-2008) to the INSDC. RL Division of Crop Protection, Indian Institute of Vegetable Research, RL Varanasi, p/o Jakhini (Shahanshapur), Varanasi, Uttar Pradesh 221305, India XX DR MD5; d2fc9ea9510425b58ebfb370bda1703c. XX FH Key Location/Qualifiers FH FT source 1..771 FT /organism="Squash leaf curl China virus" FT /host="Cucurbita pepo" FT /mol_type="genomic DNA" FT /country="India" FT /collection_date="Nov-2007" FT /db_xref="taxon:223323" FT gene 1..771 FT /gene="AV1" FT CDS 1..771 FT /codon_start=1 FT /gene="AV1" FT /product="coat protein" FT /db_xref="GOA:B6ED42" FT /db_xref="InterPro:IPR000263" FT /db_xref="InterPro:IPR000650" FT /db_xref="InterPro:IPR029053" FT /db_xref="UniProtKB/TrEMBL:B6ED42" FT /protein_id="ACI46969.1" FT /translation="MAKRPADIIISTPASKVRRRLNFDSPYGARAVVPIARVTKAKAWT FT NRPMNRKPRMYRTYRSPDVPRGCEGPCKVQSFESRHDVSHIGKVMCVSDVTRGTGLTHR FT VGKRFCVKSVYVLGKIWMDENIKTKNHTNSVMFFLVRDRRPTGSPQDFGEVFNMFDNEP FT STATVKNMHRDRYQVLRKWHATVTGGTYASREQALVRKFVRVNNYVVYNQQEAGKYENH FT TENALMLYMACTHASNPVYATLKIRIYFYDCVTN" XX SQ Sequence 771 BP; 227 A; 160 C; 188 G; 196 T; 0 other; atggcgaagc gaccagcaga tatcatcatt tcaacgcccg catcgaaggt acgccgacgt 60 ctcaacttcg acagccccta tggagctcgt gccgttgtcc ccattgcccg cgtcacaaaa 120 gcaaaggcat ggaccaacag gccgatgaac agaaaaccca gaatgtacag aacgtataga 180 agtcccgacg tgccaagggg ctgcgaaggc ccttgtaagg tgcagtcctt tgaatctagg 240 cacgatgtct ctcatattgg caaggtcatg tgtgttagtg atgttacgcg aggaaccgga 300 ctcacacatc gcgtagggaa gcgattctgt gtgaaatccg tctatgtgtt ggggaagata 360 tggatggatg aaaacatcaa gactaaaaac catactaaca gtgtcatgtt ttttttggtt 420 cgtgatcgtc gtcctacagg atctccccaa gattttgggg aagtttttaa catgtttgac 480 aatgaaccga gcacagcaac agtgaagaat atgcatcgtg atcgttatca agtcttacgg 540 aagtggcatg cgactgtgac gggaggaaca tatgcttcta gggagcaagc attagttagg 600 aaatttgtta gggtcaataa ttatgttgtt tacaatcaac aagaggccgg caagtatgag 660 aatcatactg aaaatgcatt aatgttgtat atggcctgta ctcacgcatc aaatcctgta 720 tacgctacat tgaaaatccg gatctatttt tatgattgcg taacaaatta a 771 //