ID EU688961; SV 1; linear; genomic DNA; STD; VRL; 177 BP. XX AC EU688961; XX DT 26-MAY-2008 (Rel. 95, Created) DT 26-MAY-2008 (Rel. 95, Last updated, Version 1) XX DE Tomato leaf curl New Delhi virus - [Ageratum: Northeast India] AC4 gene, DE complete cds. XX KW . XX OS Tomato leaf curl New Delhi virus - [Ageratum: Northeast India] OC Viruses; Geminiviridae; Begomovirus. XX RN [1] RP 1-177 RA Praveen S., Sharma P.K., Singh P., Mishra A.K.; RT "Cloning and Sequencing of AC4 gene"; RL Unpublished. XX RN [2] RP 1-177 RA Praveen S., Sharma P.K., Singh P., Mishra A.K.; RT ; RL Submitted (01-MAY-2008) to the INSDC. RL Plant Pathology, Indian Agricultural Research Institute, Pusa Road, New RL Delhi 110012, India XX DR MD5; 3e7b0959014cf836aaaabc1907731686. XX FH Key Location/Qualifiers FH FT source 1..177 FT /organism="Tomato leaf curl New Delhi virus - [Ageratum: FT Northeast India]" FT /isolate="Ageratum" FT /mol_type="genomic DNA" FT /country="India:northeast" FT /db_xref="taxon:530589" FT CDS 1..177 FT /codon_start=1 FT /product="AC4" FT /note="RNAi suppressor" FT /db_xref="InterPro:IPR002488" FT /db_xref="UniProtKB/TrEMBL:B2ZU79" FT /protein_id="ACD68182.1" FT /translation="MGLRISMSSSNSKGNSSAKITDSSTWFPQVGQHISIRTFRELNPR FT QTSKLTSTKTETF" XX SQ Sequence 177 BP; 52 A; 47 C; 36 G; 42 T; 0 other; atgggtctcc gcatatccat gtcctcatcc aattcgaagg gaaattccag tgcaaaaata 60 acagattctt cgacttggtt tccccaagtc ggtcagcaca tttccatccg aacattcagg 120 gagctaaatc cgcgtcagac gtcaaagctt acatcgacaa agacggagac gttctag 177 //