ID EU688960; SV 1; linear; genomic DNA; STD; VRL; 177 BP. XX AC EU688960; XX DT 26-MAY-2008 (Rel. 95, Created) DT 26-MAY-2008 (Rel. 95, Last updated, Version 1) XX DE Tomato leaf curl New Delhi virus - [Jatropha:Northeast India] AC4 gene, DE complete cds. XX KW . XX OS Tomato leaf curl New Delhi virus - [Jatropha:Northeast India] OC Viruses; Geminiviridae; Begomovirus. XX RN [1] RP 1-177 RA Praveen S., Singh P., Sharma P.K., Mishra A.K.; RT "Cloning and Sequencing of AC4 from Jatropha begomovirus"; RL Unpublished. XX RN [2] RP 1-177 RA Praveen S., Singh P., Sharma P.K., Mishra A.K.; RT ; RL Submitted (01-MAY-2008) to the INSDC. RL Plant Pathology, Indian Agricultural Research Institute, Pusa Road, New RL Delhi 110012, India XX DR MD5; e3adcf7848a8e970ec753221c7721471. XX FH Key Location/Qualifiers FH FT source 1..177 FT /organism="Tomato leaf curl New Delhi virus - FT [Jatropha:Northeast India]" FT /isolate="Jatropha" FT /mol_type="genomic DNA" FT /country="India:northeast" FT /db_xref="taxon:530588" FT CDS 1..177 FT /codon_start=1 FT /product="AC4" FT /note="RNAi suppressor" FT /db_xref="InterPro:IPR002488" FT /db_xref="UniProtKB/TrEMBL:B2ZU78" FT /protein_id="ACD68181.1" FT /translation="MGLRISMFSSNSKGNSSAKITDSSTWFPQVGQHISIRTFRELNPR FT QTSKLTSTKTETF" XX SQ Sequence 177 BP; 52 A; 46 C; 36 G; 43 T; 0 other; atgggtctcc gcatatccat gttctcatcc aattcgaagg gaaattccag tgcaaaaata 60 acagattctt cgacttggtt tccccaagtc ggtcagcaca tttccatccg aacattcagg 120 gagctaaatc cgcgtcagac gtcaaagctt acatcgacaa agacggagac gttctag 177 //