ID EU677429; SV 1; linear; genomic DNA; STD; VRL; 510 BP. XX AC EU677429; XX DT 02-AUG-2008 (Rel. 96, Created) DT 23-MAR-2009 (Rel. 100, Last updated, Version 2) XX DE Tomato yellow leaf curl virus isolate Ch12 precoat protein (V2) gene, DE complete cds; and coat protein (V1) gene, partial cds. XX KW . XX OS Tomato yellow leaf curl virus OC Viruses; Geminiviridae; Begomovirus. XX RN [1] RP 1-510 RX DOI; 10.1007/s11262-008-0310-5. RX PUBMED; 19112612. RA Fazeli R., Heydarnejad J., Massumi H., Shaabanian M., Varsani A.; RT "Genetic diversity and distribution of tomato-infecting begomoviruses in RT Iran"; RL Virus Genes 38(2):311-319(2009). XX RN [2] RP 1-510 RA Heydarnejad J., Fazeli R., Massumi H.; RT ; RL Submitted (23-APR-2008) to the INSDC. RL Plant Protection Department, Shahid Bahonar University of Kerman, 22 Bahman RL Ave, Kerman, Kerman 7616914111, Iran XX DR MD5; 01f290b303cc9c867884e3066ebe31b1. XX FH Key Location/Qualifiers FH FT source 1..510 FT /organism="Tomato yellow leaf curl virus" FT /host="Chrozophora hierosolymitana" FT /isolate="Ch12" FT /mol_type="genomic DNA" FT /country="Iran:Kerman, Jiroft" FT /db_xref="taxon:10832" FT gene 127..474 FT /gene="V2" FT CDS 127..474 FT /codon_start=1 FT /gene="V2" FT /product="precoat protein" FT /db_xref="GOA:B4YT05" FT /db_xref="InterPro:IPR002511" FT /db_xref="InterPro:IPR005159" FT /db_xref="UniProtKB/TrEMBL:B4YT05" FT /protein_id="ACF04184.1" FT /translation="MWDPLLHEFPESVHGLRCMLAVKYLKEIEKTYSPDTIGYDLVRDL FT ISVVRARNYGEASSRYLHFNARIESTPSSELRQPVCCPCSCPYCPRHKGKGMGEQTHEP FT ETKILPDVSKL" FT gene 287..>510 FT /gene="V1" FT CDS 287..>510 FT /codon_start=1 FT /gene="V1" FT /product="coat protein" FT /note="CP" FT /db_xref="GOA:B4YT06" FT /db_xref="UniProtKB/TrEMBL:B4YT06" FT /protein_id="ACF04185.1" FT /translation="MVKRPADIYISTPASKARRRLNFDSPYAVRAAVPIVRATKAREWV FT NRPMNRKPRFYRMYRSSDVPRGCEGPCKV" XX SQ Sequence 510 BP; 141 A; 123 C; 125 G; 121 T; 0 other; taatattacc ggatggccgc ggtgcctttt gtgtgggtcc agaaccaatg aaattcgaga 60 tacatggcta atttaatgca tggggaccaa taaatagact tgcgcaccaa gattggatcc 120 acaaacatgt gggatccatt attgcacgaa tttcctgaaa gcgttcatgg tcttaggtgc 180 atgctagctg taaaatatct caaagagatt gaaaagacct attctccgga cacaatcgga 240 tacgatcttg ttcgtgacct aatctctgtc gtccgtgcga gaaactatgg tgaagcgtcc 300 agcagatatc tacatttcaa cgcccgcatc gaaagcacgc cgtcgtctga acttcgacag 360 cccgtatgct gtccgtgcag ctgtccctat tgtccgcgcc acaaaggcaa gggaatgggt 420 gaacagaccc atgaaccgga aaccaagatt ttaccggatg tatcgaagct ctgacgtgcc 480 caggggctgt gaagggccat gcaaagtcca 510 //