ID EU677428; SV 1; linear; genomic DNA; STD; VRL; 522 BP. XX AC EU677428; XX DT 02-AUG-2008 (Rel. 96, Created) DT 23-MAR-2009 (Rel. 100, Last updated, Version 2) XX DE Tomato yellow leaf curl virus isolate Roodan-8 precoat protein (V2) gene, DE complete cds; and coat protein (V1) gene, partial cds. XX KW . XX OS Tomato yellow leaf curl virus OC Viruses; Geminiviridae; Begomovirus. XX RN [1] RP 1-522 RX DOI; 10.1007/s11262-008-0310-5. RX PUBMED; 19112612. RA Fazeli R., Heydarnejad J., Massumi H., Shaabanian M., Varsani A.; RT "Genetic diversity and distribution of tomato-infecting begomoviruses in RT Iran"; RL Virus Genes 38(2):311-319(2009). XX RN [2] RP 1-522 RA Heydarnejad J., Fazeli R., Massumi H.; RT ; RL Submitted (23-APR-2008) to the INSDC. RL Plant Protection Department, Shahid Bahonar University of Kerman, 22 Bahman RL Ave, Kerman, Kerman 7616914111, Iran XX DR MD5; 49fea6a2c55221a524d43528060ee1a4. XX FH Key Location/Qualifiers FH FT source 1..522 FT /organism="Tomato yellow leaf curl virus" FT /host="Lycopersicon esculentum" FT /isolate="Roodan-8" FT /mol_type="genomic DNA" FT /country="Iran:Hormozgan, Roodan" FT /db_xref="taxon:10832" FT gene 136..486 FT /gene="V2" FT CDS 136..486 FT /codon_start=1 FT /gene="V2" FT /product="precoat protein" FT /db_xref="GOA:B4YT03" FT /db_xref="InterPro:IPR002511" FT /db_xref="InterPro:IPR005159" FT /db_xref="UniProtKB/TrEMBL:B4YT03" FT /protein_id="ACF04182.1" FT /translation="MWDPLLNEFPESVHGFRCMLAIKYLQAVEETYEPNTLGHDLIRDL FT ISVVRARDYVEATRRYNHFHARLEGSPKAELRQPLQQPCCCPHCPRHKQAPIMDVQAHV FT PKAQNIQNVSKP" FT gene 296..>522 FT /gene="V1" FT CDS 296..>522 FT /codon_start=1 FT /gene="V1" FT /product="coat protein" FT /note="CP" FT /db_xref="GOA:B4YT04" FT /db_xref="InterPro:IPR000263" FT /db_xref="UniProtKB/TrEMBL:B4YT04" FT /protein_id="ACF04183.1" FT /translation="MSKRPGDIIISTPVSKVRRRLNFDSPYSSRAAAPIVQGINKRRSW FT TYRPMYRKPRIYRMYRSPDVPRGCEGPCKV" XX SQ Sequence 522 BP; 132 A; 130 C; 122 G; 138 T; 0 other; taatattacc ggatggccgc gccccacgtg ggtcccgcac atgtcgctat tgtccaatca 60 aattgatgac tgaaacgtta gataattggt tagttgtcct tataaactta gtccccaagt 120 ttgttgtcgt gcaatatgtg ggatccactt cttaatgaat ttccggaatc cgttcacgga 180 tttcgttgta tgttagctat taaatatttg caggccgttg aggaaacgta tgagcccaac 240 actttgggcc acgatttaat tagggatctt atatctgttg taagggctcg tgactatgtc 300 gaagcgaccc ggcgatataa tcatttccac gcccgtctcg aaggttcgcc gaaggctgaa 360 cttcgacagc ccctacagca gccgtgctgc tgcccccatt gtccaaggca taaacaagcg 420 ccgatcatgg acgtacaggc ccatgtaccg aaagcccaga atatacagaa tgtatcgaag 480 ccctgatgtt ccccgtggat gtgaaggccc atgcaaagtc ca 522 //