ID EU667632; SV 1; linear; genomic RNA; STD; VRL; 822 BP. XX AC EU667632; XX DT 17-MAY-2008 (Rel. 95, Created) DT 17-MAY-2008 (Rel. 95, Last updated, Version 1) XX DE Watermelon mosaic virus isolate YAZ.TA.1 polyprotein gene, partial cds. XX KW . XX OS Watermelon mosaic virus OC Viruses; Riboviria; Potyviridae; Potyvirus. XX RN [1] RP 1-822 RX DOI; 10.1007/s11262-008-0271-8. RX PUBMED; 18712590. RA Sharifi M., Massumi H., Heydarnejad J., Hosseini Pour A., Shaabanian M., RA Rahimian H.; RT "Analysis of the biological and molecular variability of Watermelon mosaic RT virus isolates from Iran"; RL Virus Genes 37(3):304-313(2008). XX RN [2] RP 1-822 RA Massumi H., Sharifi M., Shaabanian M., Heydarnejad J., Hosseini Pour A., RA Rahimian H.; RT ; RL Submitted (21-APR-2008) to the INSDC. RL Department of Plant Protection, Shahid Bahonar, Kerman University, Kerman, RL Iran XX DR MD5; 6c0f5eee15894a98fda5fd9de19354a5. XX FH Key Location/Qualifiers FH FT source 1..822 FT /organism="Watermelon mosaic virus" FT /host="Cucurbita pepo" FT /isolate="YAZ.TA.1" FT /mol_type="genomic RNA" FT /country="Iran" FT /db_xref="taxon:146500" FT CDS <1..>822 FT /codon_start=1 FT /product="polyprotein" FT /db_xref="GOA:B2ZHU5" FT /db_xref="InterPro:IPR001592" FT /db_xref="UniProtKB/TrEMBL:B2ZHU5" FT /protein_id="ACD39417.1" FT /translation="ESVSLQSGKEAVENLDAGKDSKKDTSGKGDKPQNLQTGQGSKEQT FT KTGTLQGTVNVGSKGKEVPRLQKITKKMNLPTVGGKIILSLDHLLEYKPNQVDLFNTRA FT TKTQFESWYSAVKVEYDLNDEQMGVIMNGFMVWCIDNGTSPDVNGVWVMMDGEEQVEYP FT LKPIVENAKPTLRQIMHHFSDAAEAYIEMRDSESPYMPRYGLLRNLRDRELARYAFDFY FT EVTSKTPNRAREAIAQMKAAALAGINSRLFGLDGNISTNSENTERHTARDVN" FT mat_peptide 19..822 FT /product="coat protein" XX SQ Sequence 822 BP; 289 A; 138 C; 206 G; 189 T; 0 other; gaatcagtgt ctctgcaatc aggaaaagaa gcagtagaga atttggatgc agggaaggac 60 tcgaagaagg acacaagtgg caaaggggat aagccacaaa atttgcaaac tggtcaaggt 120 agtaaagaac agacaaaaac tggcacactg caagggactg tgaatgttgg atcgaaagga 180 aaggaagtcc cacgactaca aaagataaca aagaaaatga atcttccaac agttggtggg 240 aagatcattc ttagcttaga ccatttgctt gagtacaaac ctaatcaagt tgatctgttt 300 aacactcgag caacaaaaac acagtttgaa tcatggtaca gcgcagtcaa agttgagtat 360 gatcttaatg atgagcaaat gggtgtaatt atgaatggtt ttatggtttg gtgcatcgat 420 aacggtacat ctccagatgt caatggagtg tgggtaatga tggatgggga agagcaagtt 480 gagtacccac taaagccaat tgttgaaaat gcaaagccaa ctttgagaca aatcatgcac 540 catttctcag atgcagcgga agcatatatt gaaatgagag actctgaaag tccgtatatg 600 cctagatacg gattactgag aaatttgaga gacagggaat tagcacgcta tgcttttgac 660 ttctatgagg ttacttctaa gacgccaaat agggcaagag aggcaatagc acaaatgaag 720 gccgcagctc tcgcgggaat taacagcagg ttatttggac ttgatggtaa tatctcgacc 780 aattccgaaa atactgagag gcacactgca agggacgtga at 822 //