ID EU310298; SV 1; linear; genomic RNA; STD; VRL; 822 BP. XX AC EU310298; XX DT 01-APR-2008 (Rel. 95, Created) DT 27-FEB-2011 (Rel. 108, Last updated, Version 2) XX DE Iris yellow spot virus isolate IYSV-On-Ind.1 nucleocapsid protein (N) gene, DE complete cds. XX KW . XX OS Iris yellow spot virus OC Viruses; Riboviria; Negarnaviricota; Polyploviricotina; Ellioviricetes; OC Bunyavirales; Tospoviridae; Orthotospovirus. XX RN [1] RP 1-822 RX DOI; 10.1094/PHYTO-02-10-0046. RX PUBMED; 21299415. RA Kunkalikar S.R., Poojari S., Arun B.M., Rajagopalan P.A., Chen T.C., RA Yeh S.D., Naidu R.A., Zehr U.B., Ravi K.S.; RT "Importance and genetic diversity of vegetable-infecting tospoviruses in RT India"; RL Phytopathology 101(3):367-376(2011). XX RN [2] RP 1-822 RA Ravi K.S., Kunkalikar S.R., Sudarsana P., Rajagopalan P.A., Zehr U.B., RA Naidu R.A.; RT ; RL Submitted (30-NOV-2007) to the INSDC. RL Molecular Virology, Mahyco Life Science Research Center, Dawalwadi, Jalna, RL Maharashtra 431203, India XX DR MD5; 830d5483413fb3a84ca3b23753cc6fab. XX FH Key Location/Qualifiers FH FT source 1..822 FT /organism="Iris yellow spot virus" FT /host="onion" FT /isolate="IYSV-On-Ind.1" FT /mol_type="genomic RNA" FT /country="India" FT /collected_by="S. Kunkalikar" FT /note="PCR_primers=fwd_name: MhMVLINF, rev_name: MhMVLINR" FT /db_xref="taxon:60456" FT gene 1..822 FT /gene="N" FT CDS 1..822 FT /codon_start=1 FT /gene="N" FT /product="nucleocapsid protein" FT /db_xref="GOA:B2C7T1" FT /db_xref="InterPro:IPR002517" FT /db_xref="UniProtKB/TrEMBL:B2C7T1" FT /protein_id="ACA09444.1" FT /translation="MSTVRGKPSEIEKLLSGGDADVVIESDETEGFNFKNFVLSNEGVQ FT MTFNNGYTILRNRAGIYKTIKSGKFTFQGKNIVIPSANVSPNQDDWTFRRLEGFIRAKM FT LVELIETKNEKEKQKMYEKICGLPLVSAYGLKPSSKFDATTAKIMLTLVGPLTLLASLD FT IFAATALPLAYFQNVKKEALGISRFSTYEQLCKVARVMAAKEFKFTEKYKKVFDETVKI FT LADCTPGTSGAASLIKFNEQIKILEGAFGKIVEDLGEPSKPKNPSKKDRYN" XX SQ Sequence 822 BP; 277 A; 148 C; 179 G; 218 T; 0 other; atgtctactg ttagggggaa accgtcagaa atcgagaaac ttctgtctgg cggagatgcg 60 gatgtggtga ttgaatctga tgagactgaa ggattcaatt tcaagaattt tgtgttgtca 120 aacgaaggtg tccaaatgac attcaataat ggctacacaa ttcttagaaa cagagcaggc 180 atttacaaga caataaaatc agggaaattc acattccaag gaaagaacat tgtcattcct 240 agtgctaatg ttagtcccaa tcaagacgat tggacattca ggaggttgga aggctttatc 300 agagccaaaa tgctcgtaga actgattgaa acaaagaatg aaaaagagaa gcagaaaatg 360 tatgaaaaaa tctgcgggct tcctctggtg agcgcatatg gtttaaagcc tagcagcaag 420 tttgatgcaa ctacagctaa gatcatgctg acactagttg gtcctctcac tttgttagca 480 agtcttgaca tctttgctgc gactgctctt ccattagctt atttccagaa tgtcaaaaaa 540 gaagcactcg gtataagcag attctcaact tatgagcaac tctgtaaagt tgcaagagtc 600 atggcagcaa aggaattcaa attcacagag aaatacaaaa aggtttttga tgaaactgta 660 aaaatccttg ctgactgcac tcctggaact tcgggtgctg cttcattgat caagttcaat 720 gaacagatta aaattcttga aggtgctttt ggaaagattg ttgaagacct tggtgagcct 780 tctaaaccca aaaatccctc taagaaggac agatacaact ag 822 //