ID EU200955; SV 1; linear; genomic DNA; STD; VRL; 511 BP. XX AC EU200955; XX DT 07-NOV-2007 (Rel. 93, Created) DT 07-NOV-2007 (Rel. 93, Last updated, Version 1) XX DE Malvastrum leaf curl Guangdong virus isolate Fs1 AV2 protein (AV2) gene, DE complete cds; and coat protein (AV1) gene, partial cds. XX KW . XX OS Malvastrum leaf curl Guangdong virus OC Viruses; Geminiviridae; Begomovirus. XX RN [1] RP 1-511 RA Yang C.X.; RT "Molecular characterization of Malvastrum coromandelianum-infecting RT begomoviruses in Fujian, China"; RL Unpublished. XX RN [2] RP 1-511 RA Xie L.H.; RT ; RL Submitted (10-OCT-2007) to the INSDC. RL Institute of Plant Virology, Fujian Agriculture and Forestry University, RL Kingshan Road, Fuzhou, Fujian 350002, China XX DR MD5; 65cc62125a31488198c35893f971adde. XX FH Key Location/Qualifiers FH FT source 1..511 FT /organism="Malvastrum leaf curl Guangdong virus" FT /host="Malvastrum coromandelianum" FT /isolate="Fs1" FT /mol_type="genomic DNA" FT /country="China" FT /db_xref="taxon:377610" FT gene 125..475 FT /gene="AV2" FT CDS 125..475 FT /codon_start=1 FT /gene="AV2" FT /product="AV2 protein" FT /db_xref="GOA:A8W933" FT /db_xref="InterPro:IPR002511" FT /db_xref="InterPro:IPR005159" FT /db_xref="UniProtKB/TrEMBL:A8W933" FT /protein_id="ABW87623.1" FT /translation="MWDPLVNEFPDTAHGFRCMLAVKYLQLVESTYSPDTLGYDLIRDL FT ISVLRARNYVEATSRYCHFHTRFEGTTPSQLRQPLQQSCCCPHCPRHKQKENMGQPAHV FT QEAQNVQNVQKP" FT gene 285..>511 FT /gene="AV1" FT CDS 285..>511 FT /codon_start=1 FT /gene="AV1" FT /product="coat protein" FT /db_xref="GOA:A8W934" FT /db_xref="InterPro:IPR000263" FT /db_xref="UniProtKB/TrEMBL:A8W934" FT /protein_id="ABW87624.1" FT /translation="MSKRPADIVISTPASKVRRRLNFDSPYNNRAAAPTVLVTNKRRTW FT VNRPMYRKPRMYRMYKSPDVPRGCEGPCKV" XX SQ Sequence 511 BP; 133 A; 131 C; 111 G; 136 T; 0 other; taatattacc ggttggccgc gaaaaatctt agtggtgggc cctcgacgaa tagaatcgcg 60 cgttcatcgc ttagttatcg cgcgttccct atttaaaact tggtccctaa gtttcgcttc 120 aaaaatgtgg gatccacttg tgaacgagtt ccctgatacc gctcatggtt ttaggtgtat 180 gctcgctgta aaatacttgc agttagtaga atctacgtat tcacctgata cactcggtta 240 cgatcttatc cgagatttaa tttctgtctt acgtgcaagg aattatgtcg aagcgaccag 300 cagatattgt catttccaca cccgcttcga aggtacgacg ccgtctcaac ttcgacagcc 360 cttacaacaa tcgtgctgct gcccccactg tcctcgtcac aaacaaaagg agaacatggg 420 tcaaccggcc catgtacagg aagcccagaa tgtacagaat gtacaaaagc cctgatgtcc 480 ctcgtggatg tgaaggccct tgcaaagtcc a 511 //