ID EU143754; SV 1; linear; genomic DNA; STD; VRL; 1026 BP. XX AC EU143754; XX DT 29-DEC-2007 (Rel. 94, Created) DT 23-JUL-2009 (Rel. 101, Last updated, Version 2) XX DE Tomato yellow leaf curl virus-Mild from squash C1 and C4 genes, partial DE cds; V2 gene, complete cds; and V1 gene, partial cds. XX KW . XX OS Tomato yellow leaf curl virus - Mild OC Viruses; Geminiviridae; Begomovirus. XX RN [1] RP 1-1026 RX DOI; 10.1111/j.1365-3059.2009.02060.x. RX AGRICOLA; IND44235486. RA Anfoka G., Haj Ahmad F., Abhary M., Hussein A.; RT "Detection and molecular characterization of viruses associated with tomato RT yellow leaf curl disease in cucurbit crops in Jordan"; RL Plant Pathol. 58(4):754-762(2009). XX RN [2] RP 1-1026 RA Anfoka G.H., Abhary M.K., Haj Ahmad F.W.; RT "Cucurbits are natural hosts for viruses that cause Tomato yellow leaf curl RT disease"; RL Unpublished. XX RN [3] RP 1-1026 RA Anfoka G.H., Abhary M.K., Haj Ahmad F.W.; RT ; RL Submitted (08-SEP-2007) to the INSDC. RL Department of Biotechnology, Faculty of Agricultural Technology, Al-Balqa RL Applied University, AL-Salt 19117, Jordan XX DR MD5; a424fe56ec0f05c14de78cc2d2428baa. XX FH Key Location/Qualifiers FH FT source 1..1026 FT /organism="Tomato yellow leaf curl virus - Mild" FT /host="squash" FT /mol_type="genomic DNA" FT /country="Jordan" FT /db_xref="taxon:220944" FT CDS complement(<1..292) FT /codon_start=1 FT /product="C1" FT /db_xref="GOA:A9YC15" FT /db_xref="InterPro:IPR001191" FT /db_xref="InterPro:IPR001301" FT /db_xref="InterPro:IPR022690" FT /db_xref="UniProtKB/TrEMBL:A9YC15" FT /protein_id="ABX60433.1" FT /translation="MAPPKRFQINCKNYFLTYPHCSLTKEEALSQLKNLETPTNKKYIK FT VCRELHENGEPHLHVLIQFEGKFKCQNQRFFDLVSPSRAAHFHPNIQAAKSS" FT CDS complement(<1..135) FT /codon_start=1 FT /product="C4" FT /db_xref="InterPro:IPR002488" FT /db_xref="UniProtKB/TrEMBL:A9YC16" FT /protein_id="ABX60430.1" FT /translation="MGNHISMCLSNLKGNSNAKISDSSTWYPQAGQHISIQTFRQLRAL FT " FT CDS 609..959 FT /codon_start=1 FT /product="V2" FT /db_xref="GOA:Q76QW5" FT /db_xref="InterPro:IPR002511" FT /db_xref="InterPro:IPR005159" FT /db_xref="UniProtKB/TrEMBL:Q76QW5" FT /protein_id="ABX60431.1" FT /translation="MWDPLLNEFPESVHGFRCMLAIKYLQSVEETYEPNTLGHDLIRDL FT ISVVRARDYVEATRRYNHFHARLEGSPKAELRQPIQQPCCCPHCPRHKQATIMDVQAHV FT PKAQNIQNVSKP" FT CDS 769..>1026 FT /codon_start=1 FT /product="V1" FT /db_xref="GOA:A9YC18" FT /db_xref="InterPro:IPR000263" FT /db_xref="UniProtKB/TrEMBL:A9YC18" FT /protein_id="ABX60432.1" FT /translation="MSKRPGDIIISTPVSKVRRRLNFDSPYSSRAAVPIVQGTNKRRSW FT TYRPMYRKPRIYRMYRSPDVPRGCEGPCKVQSFEQRDDIKH" XX SQ Sequence 1026 BP; 278 A; 206 C; 225 G; 317 T; 0 other; aagagctctt agctgcctga atgtttggat ggaaatgtgc tgccctgctt ggggatacca 60 ggtcgaagaa tcgctgattt tggcatttga atttcccttc aaattggata agcacatgga 120 gatgtggttc cccattctcg tggagttctc tgcaaacttt gatgtatttt ttatttgttg 180 gggtttctag gttttttaat tgggaaagtg cttcttcttt tgttaaggag caatgaggat 240 atgtgaggaa ataatttttg caatttattt ggaagcgctt aggaggagcc atatggtcaa 300 tgagtaccga ttgaccaaga tttttacact tatccctggt gtatcggtac tcaatatata 360 gtgagtacca aatggcattt tggtaataac ataaaagtac attgcaattc aaaattcaaa 420 ttaaaaaatc aaatcattaa agcggccatc cgtataatat taccggatgg ccgcgccttt 480 ttcttttatg tggtccccac gagggttcca cagacgtcac tgtcaaccaa tcaaattgca 540 tcctcaaacg ttagataagt gtttatttgt ctttatatac ttggtcccca agttttttgt 600 cttgcaatat gtgggaccca cttctaaatg aatttcctga atctgttcac ggatttcgtt 660 gtatgttagc tattaaatat ttgcagtccg ttgaggaaac ttacgagccc aatacattgg 720 gccacgattt aattagggat cttatatctg ttgtaagggc ccgtgactat gtcgaagcga 780 ccaggcgata taatcatttc cacgcccgtc tcgaaggttc gccgaaggct gaacttcgac 840 agcccataca gcagccgtgc tgctgtcccc attgtccaag gcacaaacaa gcgacgatca 900 tggacgtaca ggcccatgta ccgaaagccc agaatataca gaatgtatcg aagccctgat 960 gttccccgtg gatgtgaagg cccatgtaaa gtccaatctt ttgagcaacg ggatgatatt 1020 aagcat 1026 //