ID EU006071; SV 1; linear; genomic DNA; STD; VRL; 177 BP. XX AC EU006071; XX DT 19-AUG-2007 (Rel. 92, Created) DT 28-AUG-2007 (Rel. 93, Last updated, Version 2) XX DE Tomato leaf curl New Delhi virus from papaya AC4 protein gene, complete DE cds. XX KW . XX OS Tomato leaf curl New Delhi virus OC Viruses; Geminiviridae; Begomovirus. XX RN [1] RP 1-177 RA Praveen S., Mishra A.K., Mangrauthia S.K., Jain R.K.; RT ; RL Submitted (29-JUN-2007) to the INSDC. RL Division of Plant Pathology, Indian Agricultural Research Institute, IARI, RL New Delhi, New Delhi 110012, India XX DR MD5; 982c9c1282327623bd7a1ee8316a47ed. XX FH Key Location/Qualifiers FH FT source 1..177 FT /organism="Tomato leaf curl New Delhi virus" FT /host="papaya" FT /mol_type="genomic DNA" FT /country="India:New Delhi" FT /db_xref="taxon:223347" FT CDS 1..177 FT /codon_start=1 FT /product="AC4 protein" FT /note="RNAi suppressor; pathogenicity determinant" FT /db_xref="InterPro:IPR002488" FT /db_xref="UniProtKB/TrEMBL:A7U6D0" FT /protein_id="ABU40641.1" FT /translation="MGLRISMFSSNSKGNSSAKITDSSTWFPQVGQHISIRTFRELNQR FT QMSKHTSTKTETF" XX SQ Sequence 177 BP; 54 A; 44 C; 36 G; 43 T; 0 other; atgggtctcc gcatatccat gttctcatcc aattcgaagg gaaattccag tgcaaaaata 60 acagattctt cgacttggtt tccccaagtc ggtcagcaca tttccatccg aacattcagg 120 gagctaaatc agcgtcagat gtcaaagcat acatcgacaa agacggagac gttctag 177 //