ID EU006069; SV 1; linear; genomic DNA; STD; VRL; 198 BP. XX AC EU006069; XX DT 19-AUG-2007 (Rel. 92, Created) DT 28-AUG-2007 (Rel. 93, Last updated, Version 2) XX DE Tomato leaf curl New Delhi virus from tobacco AC4 protein gene, complete DE cds. XX KW . XX OS Tomato leaf curl New Delhi virus OC Viruses; Geminiviridae; Begomovirus. XX RN [1] RP 1-198 RA Praveen S., Mishra A.K., Singh P.; RT ; RL Submitted (29-JUN-2007) to the INSDC. RL Division of Plant Pathology, Indian Agricultural Research Institute, IARI, RL New Delhi, New Delhi 110012, India XX DR MD5; 32cc591d4b6ee0844375fb55ae33f761. XX FH Key Location/Qualifiers FH FT source 1..198 FT /organism="Tomato leaf curl New Delhi virus" FT /host="tobacco" FT /mol_type="genomic DNA" FT /country="India:New Delhi" FT /db_xref="taxon:223347" FT CDS 1..198 FT /codon_start=1 FT /product="AC4 protein" FT /note="RNAi suppressor; pathogenicity determinant" FT /db_xref="UniProtKB/TrEMBL:A7U6C8" FT /protein_id="ABU40639.1" FT /translation="MGLLISMIAANSTGDSGANTCVYSTSFPQLTLHDSILTVRMIVGI FT TFNHDRLSVLRLCQSRSRPP" XX SQ Sequence 198 BP; 40 A; 55 C; 43 G; 60 T; 0 other; atgggtctcc ttatctcgat gatcgcggcc aattcgactg gcgattccgg agcgaataca 60 tgcgtgtact cgacttcgtt tcctcaactt actctgcatg atagcatcct tactgtcagg 120 atgatagtgg gaatcacctt taatcatgac cggctttccg tacttcgtct ttgccagtca 180 cgttctaggc ccccatga 198 //