ID EU006067; SV 1; linear; genomic RNA; STD; VRL; 336 BP. XX AC EU006067; XX DT 19-AUG-2007 (Rel. 92, Created) DT 28-AUG-2007 (Rel. 93, Last updated, Version 2) XX DE Cucumber mosaic virus 2b protein gene, complete cds. XX KW . XX OS Cucumber mosaic virus (cucumber mosaic cucumovirus) OC Viruses; Riboviria; Bromoviridae; Cucumovirus. XX RN [1] RP 1-336 RX DOI; 10.1007/s11262-008-0232-2. RX PUBMED; 18438704. RA Praveen S., Mangrauthia S.K., Singh P., Mishra A.K.; RT "Behavior of RNAi suppressor protein 2b of Cucumber mosaic virus in planta RT in presence and absence of virus"; RL Virus Genes 37(1):96-102(2008). XX RN [2] RP 1-336 RA Praveen S., Singh P., Mangrauthia S.K., Koundal V., Mishra A.K.; RT ; RL Submitted (29-JUN-2007) to the INSDC. RL Division of Plant Pathology, Indian Agricultural Research Institute, IARI, RL New Delhi, New Delhi 110012, India XX DR MD5; bf5ba4529cdc1508df7a736238fa6980. DR EuropePMC; PMC3550809; 23730005. XX FH Key Location/Qualifiers FH FT source 1..336 FT /organism="Cucumber mosaic virus" FT /mol_type="genomic RNA" FT /country="India:New Delhi" FT /db_xref="taxon:12305" FT CDS 1..336 FT /codon_start=1 FT /product="2b protein" FT /note="RNAi suppressor" FT /db_xref="InterPro:IPR004946" FT /db_xref="UniProtKB/TrEMBL:A7U6C6" FT /protein_id="ABU40642.1" FT /translation="MELNEGAATNVELQLARMMEVRRQRRKSHKKNRRERGHKSPSERA FT RSNLRLFRFLPFCQIDGSELIEMYHHASVVELSESEAPRFTLPAEEDHDFDDTDWFAGN FT DWAEGSF" XX SQ Sequence 336 BP; 95 A; 68 C; 100 G; 73 T; 0 other; atggaattga acgaaggcgc agcgacaaac gtcgaactcc aactggctcg tatgatggag 60 gtgaggagac aaagacgaaa gtctcacaag aagaatcgac gggaacgagg tcacaaaagt 120 cccagcgaga gggcgcgttc aaatctcaga ctattccgat ttttaccgtt ttgtcagata 180 gatggttcgg aactaataga gatgtaccac cacgcgagtg tggtggaatt gtccgagtct 240 gaggctcctc ggtttacgtt gccagcggaa gaagaccatg attttgacga cacagattgg 300 ttcgctggta atgactgggc ggaagggtcg ttctga 336 //