ID EF710773; SV 1; linear; genomic RNA; STD; VRL; 333 BP. XX AC EF710773; XX DT 06-AUG-2007 (Rel. 92, Created) DT 16-JUL-2008 (Rel. 96, Last updated, Version 2) XX DE Cucumber mosaic virus clone DP-2b1 long distance movement protein gene, DE complete cds. XX KW . XX OS Cucumber mosaic virus (cucumber mosaic cucumovirus) OC Viruses; Riboviria; Bromoviridae; Cucumovirus. XX RN [1] RP 1-333 RX DOI; 10.1007/s12038-008-0042-7. RX PUBMED; 18535359. RA Srivastava A., Raj S.K.; RT "Coat protein-mediated resistance against an Indian isolate of the Cucumber RT mosaic virus subgroup IB in Nicotiana benthamiana"; RL J. Biosci. 33(2):249-257(2008). XX RN [2] RP 1-333 RA Pratap D., Kumar S., Raj S.K.; RT "RNA 2b ORF cds of Cucumber mosaic virus causing shoestring on tomato"; RL Unpublished. XX RN [3] RP 1-333 RA Pratap D., Kumar S., Raj S.K.; RT ; RL Submitted (22-JUN-2007) to the INSDC. RL Molecular Virology, National Botanical Research Institute, Rana Pratap RL Marg, Lucknow, U.P 226001, India XX DR MD5; 5e1595ba28eea5ebe1a50740b915166c. XX FH Key Location/Qualifiers FH FT source 1..333 FT /organism="Cucumber mosaic virus" FT /host="Solanum lycopersicum L." FT /lab_host="Nicotiana glutinosa" FT /mol_type="genomic RNA" FT /country="India" FT /clone="DP-2b1" FT /note="subgroup: IB" FT /db_xref="taxon:12305" FT CDS 1..333 FT /codon_start=1 FT /product="long distance movement protein" FT /db_xref="InterPro:IPR004946" FT /db_xref="UniProtKB/TrEMBL:A7LBA2" FT /protein_id="ABS76465.1" FT /translation="MELNAGAMTNVELQLARMVEVKRQRRRSHMKNRRERGHKSPSERA FT RSNLRLFRFLPFYQVDGPELIELHRVNMVELSESEAPRLSLLVEEDHDFDDTDWFAGNE FT WAEGSF" XX SQ Sequence 333 BP; 90 A; 67 C; 99 G; 77 T; 0 other; atggaattga acgcaggcgc aatgacaaac gtcgaactcc aactggctcg tatggtggag 60 gtgaaaagac agagacgaag gtctcacatg aagaatcgac gggaacgagg tcacaaaagt 120 cccagcgaga gggcgcgttc gaatctcaga ttgttccgct tcctaccatt ttatcaggtg 180 gatggtccgg aattgataga gctccaccgt gtgaacatgg tggaattatc cgaatctgag 240 gcccctcgtt tatcgttact agtggaagaa gaccatgatt ttgacgatac ggattggttc 300 gctggtaacg agtgggcgga agggtcgttt tga 333 //