ID EF635933; SV 1; linear; mRNA; STD; VRL; 613 BP. XX AC EF635933; XX DT 01-JAN-2009 (Rel. 98, Created) DT 01-JAN-2009 (Rel. 98, Last updated, Version 1) XX DE Sugarcane yellow leaf virus isolate CB86032 putative aphid transmission DE factor mRNA, partial cds; and capsid protein and movement protein mRNA, DE complete cds. XX KW . XX OS Sugarcane yellow leaf virus OC Viruses; Riboviria; Luteoviridae; Polerovirus. XX RN [1] RP 1-613 RA Viswanathan R., Balamuralikrishnan M., Karuppaiah R.; RT "Detection and molecular characterization of sugarcane yellow leaf virus, RT causing yellow leaf of sugarcane in tropical India"; RL Unpublished. XX RN [2] RP 1-613 RA Viswanathan R., Balamuralikrishnan M., Karuppaiah R.; RT ; RL Submitted (30-MAY-2007) to the INSDC. RL Plant Pathology, Sugarcane Breeding Institute, Sugarcane (post), RL Coimbatore, Tamil Nadu 641 007, India XX DR MD5; d6902cca2b4c1722a7498db425533c83. XX FH Key Location/Qualifiers FH FT source 1..613 FT /organism="Sugarcane yellow leaf virus" FT /host="Saccharum sp. hybrid, variety Co 86032" FT /isolate="CB86032" FT /mol_type="mRNA" FT /country="India" FT /clone="2" FT /db_xref="taxon:94290" FT CDS 1..>613 FT /codon_start=1 FT /transl_except=(pos:589..591,aa:OTHER) FT /product="putative aphid transmission factor" FT /note="ORF5; produced by translational readthrough of TAG FT stop codon of ORF3" FT /db_xref="GOA:B8LJ52" FT /db_xref="InterPro:IPR001517" FT /db_xref="InterPro:IPR029053" FT /db_xref="UniProtKB/TrEMBL:B8LJ52" FT /protein_id="ACB87405.1" FT /translation="MNTGANRSRRNVRRRANRRRQTRPVVVVRPAAGPRRVRRRRARVG FT GNAVRGPGGRSNRDVLTFTIDDLKANSTGILKFGPNLSQYAAFSNGLLKAYHEYKITSL FT TIQYNSCSSDATPGAIALEVDTSCSQTTTGSKITSFPVKRNAKKTFPAPFIRGKDFMTT FT SADQFWLLYKGNGDGSLAGQFVCRFECLFQNPKXVGDAPPT" FT CDS 1..591 FT /codon_start=1 FT /product="capsid protein" FT /note="ORF3" FT /db_xref="GOA:B8LJ53" FT /db_xref="InterPro:IPR001517" FT /db_xref="InterPro:IPR029053" FT /db_xref="UniProtKB/TrEMBL:B8LJ53" FT /protein_id="ACB87403.1" FT /translation="MNTGANRSRRNVRRRANRRRQTRPVVVVRPAAGPRRVRRRRARVG FT GNAVRGPGGRSNRDVLTFTIDDLKANSTGILKFGPNLSQYAAFSNGLLKAYHEYKITSL FT TIQYNSCSSDATPGAIALEVDTSCSQTTTGSKITSFPVKRNAKKTFPAPFIRGKDFMTT FT SADQFWLLYKGNGDGSLAGQFVCRFECLFQNPK" FT CDS 32..484 FT /codon_start=1 FT /product="movement protein" FT /note="ORF4" FT /db_xref="InterPro:IPR001964" FT /db_xref="UniProtKB/TrEMBL:B8LJ54" FT /protein_id="ACB87404.1" FT /translation="MSEDALTVVDRLGQWSWSGLPQDLDEYDDVEHVLEETLCEDREEE FT ATGMFSLSRLTISRPTQPGSSNSDRTYLSTQRSAMAYSRPTMSIKSQVSQFSITHAPPT FT QLQVQSHLKWIHPAPKQQQAPRLLASPSRGTPRKPSRPPSSGGKTS" XX SQ Sequence 613 BP; 174 A; 169 C; 148 G; 122 T; 0 other; atgaatacgg gcgctaaccg ttcacgaagg aatgtcagaa gacgcgctaa ccgtcgtcga 60 cagactcggc cagtggtcgt ggtccggcct gccgcaggac ctagacgagt acgacgacgt 120 agagcacgtg ttggaggaaa cgctgtgcga ggaccgggag gaagaagcaa cagggatgtt 180 ctcactttca cgattgacga tctcaaggcc aactcaaccg ggatcctcaa attcggaccg 240 aacctatctc agtacgcagc gttcagcaat ggcttactca aggcctacca tgagtataaa 300 atcacaagtc tcacaattca gtataactca tgctcctccg acgcaactcc aggtgcaatc 360 gcacttgaag tggatacatc ctgctcccaa acaacaacag gctccaagat tactagcttc 420 cccgtcaaga ggaacgccaa gaaaaccttc ccggccccct tcatcagggg gaaagacttc 480 atgactacat cagctgatca gttttggctt ttgtacaaag ggaatggaga cggaagccta 540 gcaggacaat tcgtctgccg atttgaatgt ttattccaga atcccaaata ggtaggcgac 600 gctcccccaa cac 613 //