ID EF565268; SV 1; linear; genomic RNA; STD; VRL; 681 BP. XX AC EF565268; XX DT 27-APR-2008 (Rel. 95, Created) DT 27-APR-2008 (Rel. 95, Last updated, Version 1) XX DE Prunus necrotic ringspot virus isolate PchUy.ear1 coat protein (CP) gene, DE complete cds. XX KW . XX OS Prunus necrotic ringspot virus OC Viruses; Riboviria; Bromoviridae; Ilarvirus. XX RN [1] RP 1-681 RX DOI; 10.1007/s00705-008-0066-1. RX PUBMED; 18365129. RA Fiore N., Fajardo T.V., Prodan S., Herranz M.C., Aparicio F., RA Montealegre J., Elena S.F., Pallas V., Sanchez-Navarro J.; RT "Genetic diversity of the movement and coat protein genes of South American RT isolates of Prunus necrotic ringspot virus"; RL Arch. Virol. 153(5):909-919(2008). XX RN [2] RP 1-681 RA Nicola F., Fajardo T., Prodan S., Herranz M.C., Aparicio F., RA Montealegre J., Pallas V., Sanchez-Navarro J.A.; RT ; RL Submitted (19-APR-2007) to the INSDC. RL Biologia del Estres, IBMCP (UPV-CSIC), Av. de los Naranjos s/n, Valencia RL 46022, Spain XX DR MD5; 084346d3c4f5b74c1024e2f6ae960446. XX FH Key Location/Qualifiers FH FT source 1..681 FT /organism="Prunus necrotic ringspot virus" FT /segment="RNA3" FT /host="Peach cv. Early Grande" FT /isolate="PchUy.ear1" FT /mol_type="genomic RNA" FT /country="Uruguay" FT /db_xref="taxon:37733" FT gene 1..681 FT /gene="CP" FT CDS 1..681 FT /codon_start=1 FT /gene="CP" FT /product="coat protein" FT /db_xref="GOA:B2KND0" FT /db_xref="InterPro:IPR002681" FT /db_xref="UniProtKB/TrEMBL:B2KND0" FT /protein_id="ABU49909.1" FT /translation="MVCRICNHTHAGGCRSCKKCHPNDALVPLRAQQRAANNPNRNRNP FT NRVSSGIGPAVRPQPVVKTTWTVRGPNVPPRIPKGYVAHNHREVTTTEAVKYLSIDFTT FT TLPQLMGQNLTLLTVIVRMNSMSSNGWIGMVEDYKVDQPDGPNALSRKGFLKDQPRGWQ FT FEPPSDLDFDTFARTHRVVIEFKTEVPAGAKVLVRDLYVVVSDLPRVQIPTDVLLVDED FT LLEI" XX SQ Sequence 681 BP; 166 A; 157 C; 192 G; 166 T; 0 other; atggtttgcc gaatttgcaa tcatacccac gctggtggat gccgttcttg caagaagtgc 60 catccgaatg atgctctggt cccactcagg gctcaacaaa gggctgcgaa caacccgaat 120 aggaatagga acccgaatag ggtttcgagc ggtataggac ctgcggtccg accgcaaccg 180 gtcgtgaaga ccacttggac cgtgaggggt ccgaatgtgc ctccccgaat tcccaagggt 240 tatgtagcac ataatcaccg agaggtgacg acgacagagg cagtgaagta cttgagtatt 300 gacttcacga ccactctccc tcagttgatg ggtcagaatt tgaccttatt aactgtcata 360 gtccgaatga actctatgag ttcgaatggt tggattggga tggtggagga ctataaggtg 420 gatcaacctg atggtccgaa tgccctgtct aggaaggggt tcttgaagga ccaaccgaga 480 ggttggcagt tcgaacctcc ctccgattta gatttcgaca cttttgcgcg tacgcatcgt 540 gtcgtcatcg aattcaagac cgaagtgccc gctggggcca aggtcttggt tagggatttg 600 tacgtagtgg taagtgactt accacgagtg caaattccga ctgatgtctt gctggtcgat 660 gaagacctgc ttgagatcta g 681 //