ID EF565253; SV 1; linear; genomic RNA; STD; VRL; 675 BP. XX AC EF565253; XX DT 27-APR-2008 (Rel. 95, Created) DT 27-APR-2008 (Rel. 95, Last updated, Version 1) XX DE Prunus necrotic ringspot virus isolate NctCl.aug1 coat protein (CP) gene, DE complete cds. XX KW . XX OS Prunus necrotic ringspot virus OC Viruses; Riboviria; Bromoviridae; Ilarvirus. XX RN [1] RP 1-675 RX DOI; 10.1007/s00705-008-0066-1. RX PUBMED; 18365129. RA Fiore N., Fajardo T.V., Prodan S., Herranz M.C., Aparicio F., RA Montealegre J., Elena S.F., Pallas V., Sanchez-Navarro J.; RT "Genetic diversity of the movement and coat protein genes of South American RT isolates of Prunus necrotic ringspot virus"; RL Arch. Virol. 153(5):909-919(2008). XX RN [2] RP 1-675 RA Nicola F., Fajardo T., Prodan S., Herranz M.C., Aparicio F., RA Montealegre J., Pallas V., Sanchez-Navarro J.A.; RT ; RL Submitted (19-APR-2007) to the INSDC. RL Biologia del Estres, IBMCP (UPV-CSIC), Av. de los Naranjos s/n, Valencia RL 46022, Spain XX DR MD5; 491b5ad6fd11b6679581a80b610be18e. XX FH Key Location/Qualifiers FH FT source 1..675 FT /organism="Prunus necrotic ringspot virus" FT /segment="RNA3" FT /host="Nectarine cv. August Fire" FT /isolate="NctCl.aug1" FT /mol_type="genomic RNA" FT /country="Chile" FT /db_xref="taxon:37733" FT gene 1..675 FT /gene="CP" FT CDS 1..675 FT /codon_start=1 FT /gene="CP" FT /product="coat protein" FT /db_xref="GOA:B2KNB5" FT /db_xref="InterPro:IPR002681" FT /db_xref="UniProtKB/TrEMBL:B2KNB5" FT /protein_id="ABU49894.1" FT /translation="MVCRICNHTHAGGCRSCKKCHPNDALVPLRAQQRAANNPNRNPVR FT VSNVVGPVVRPKSVVKTTWTVRGPNVPPRIPKGFVAHSHREVTTTEAVKYLSVDFTTTF FT PQLMGQNLTLLTIINRMNSMSSNGWIGIVEDYRVNNPEGPNALSRKGFLKDQPRGWQFE FT PPSDLDFDTFARTHRIVIEFKTEVPAGAKVLVRDLYVVVSDLPRVQIPTDVLLVDEDLL FT EI" XX SQ Sequence 675 BP; 170 A; 147 C; 184 G; 174 T; 0 other; atggtttgcc gaatttgcaa tcatacccac gctggtggat gccgttcttg caagaagtgc 60 catccgaatg atgctctggt cccactcaga gctcaacaaa gggctgcgaa taacccgaat 120 agaaacccgg tgagggtttc gaatgttgta ggacctgtag tccgacctaa atcagtcgtg 180 aagactactt ggactgttag aggtccgaat gtgccacccc gaatacccaa gggttttgtt 240 gcacatagtc accgtgaggt gacgactact gaggcagtga agtaccttag tgttgacttc 300 acgaccactt tcccgcagtt gatgggtcaa aatttgactc ttttaacgat tatcaaccga 360 atgaactcca tgagttcgaa tggttggata gggatcgtgg aggactatag ggtgaataac 420 cccgagggtc cgaatgcctt gtctaggaag gggttcttga aggaccaacc gagaggttgg 480 caatttgaac cgccatccga tttagatttc gatacttttg cgaggacgca tcgtatcgtt 540 atcgaattca agaccgaagt gcccgctggg gcaaaggtct tggttaggga cttgtacgta 600 gtggtaagtg atttaccacg agtgcagatc ccgactgatg tcttgctggt cgatgaagac 660 ctgcttgaga tctag 675 //