ID EF565252; SV 1; linear; genomic RNA; STD; VRL; 675 BP. XX AC EF565252; XX DT 27-APR-2008 (Rel. 95, Created) DT 27-APR-2008 (Rel. 95, Last updated, Version 1) XX DE Prunus necrotic ringspot virus isolate NctCl.ear1 coat protein (CP) gene, DE complete cds. XX KW . XX OS Prunus necrotic ringspot virus OC Viruses; Riboviria; Bromoviridae; Ilarvirus. XX RN [1] RP 1-675 RX DOI; 10.1007/s00705-008-0066-1. RX PUBMED; 18365129. RA Fiore N., Fajardo T.V., Prodan S., Herranz M.C., Aparicio F., RA Montealegre J., Elena S.F., Pallas V., Sanchez-Navarro J.; RT "Genetic diversity of the movement and coat protein genes of South American RT isolates of Prunus necrotic ringspot virus"; RL Arch. Virol. 153(5):909-919(2008). XX RN [2] RP 1-675 RA Nicola F., Fajardo T., Prodan S., Herranz M.C., Aparicio F., RA Montealegre J., Pallas V., Sanchez-Navarro J.A.; RT ; RL Submitted (19-APR-2007) to the INSDC. RL Biologia del Estres, IBMCP (UPV-CSIC), Av. de los Naranjos s/n, Valencia RL 46022, Spain XX DR MD5; 9c8c2857c7e4c7fede7b07e4db462af6. XX FH Key Location/Qualifiers FH FT source 1..675 FT /organism="Prunus necrotic ringspot virus" FT /segment="RNA3" FT /host="Nectarine cv. Early John" FT /isolate="NctCl.ear1" FT /mol_type="genomic RNA" FT /country="Chile" FT /db_xref="taxon:37733" FT gene 1..675 FT /gene="CP" FT CDS 1..675 FT /codon_start=1 FT /gene="CP" FT /product="coat protein" FT /db_xref="GOA:Q9YKE6" FT /db_xref="InterPro:IPR002681" FT /db_xref="UniProtKB/TrEMBL:Q9YKE6" FT /protein_id="ABU49893.1" FT /translation="MVCRICNHTHAGGCRSCKKCHPNGALVPLRAQQRAANNPNRNPNR FT ASSGTGPVVRPQPVVKTTWTVRGPNVPPRIPKGFVAHNHREVTTTEAVKYLSIDFTTTL FT PQLMGQNLTLLTVIVRMNSMSSNGWIGMVEDYKVEQPDGPNALSRKGFLKDQPRGWQFE FT PPSDLDFDTFARTHRVVIEFKTEVPAGAKVLVRDLYVVVSDLPRVQIPTDVLLVDEDLL FT EI" XX SQ Sequence 675 BP; 165 A; 156 C; 191 G; 163 T; 0 other; atggtttgcc gaatttgcaa tcatacccac gctggtggat gccgttcttg caagaagtgc 60 catccgaatg gagctctggt cccactcagg gctcaacaga gggctgcgaa taacccgaat 120 agaaacccga atagggcttc gagtggtacc ggaccagtgg tccgaccaca accggtcgtg 180 aagaccacct ggaccgtgag aggtccgaat gtgcctcccc gaattcctaa ggggtttgta 240 gcacacaatc accgagaggt gacgacgaca gaggcagtga agtacttgag catagacttc 300 acgaccactc tccctcagtt gatgggtcag aatttgaccc tattgactgt tatagtccga 360 atgaactcta tgagttcgaa tggttggatt gggatggtgg aggactataa ggtggaacaa 420 cctgatggtc cgaatgccct gtctaggaag gggttcttga aggaccaacc gagaggttgg 480 cagttcgaac ctccttccga tttagatttc gacacttttg cgcgtacgca tcgtgtcgtt 540 atcgaattca agaccgaagt gcccgctggg gccaaggtct tggttaggga tttgtacgta 600 gtggtaagtg atttaccacg agtgcaaatt ccgactgatg tcttgctggt cgatgaagac 660 ctgcttgaga tctag 675 //