ID EF408181; SV 1; linear; genomic RNA; STD; VRL; 786 BP. XX AC EF408181; XX DT 31-OCT-2008 (Rel. 97, Created) DT 29-DEC-2008 (Rel. 98, Last updated, Version 2) XX DE Barley yellow dwarf virus-MAV isolate MAV LMB1 RNA-dependent RNA polymerase DE P2 fusion protein and coat protein P3 genes, partial cds; and movement DE protein P4 gene, complete cds. XX KW . XX OS Barley yellow dwarf virus MAV OC Viruses; Riboviria; Luteoviridae; Luteovirus. XX RN [1] RP 1-786 RA Delmiglio C., Pearson M.N.; RT "Sequence variation of barley yellow dwarf viruses from New Zealand RT grasses"; RL Unpublished. XX RN [2] RP 1-786 RA Delmiglio C., Pearson M.N.; RT ; RL Submitted (29-JAN-2007) to the INSDC. RL School of Biological Sciences, The University of Auckland, 3A Symonds St., RL Private Bag 92019, Auckland 1142, New Zealand XX DR MD5; 640d71efc0e254def739aa4bde624549. XX FH Key Location/Qualifiers FH FT source 1..786 FT /organism="Barley yellow dwarf virus MAV" FT /host="Festuca novae-zelandiae" FT /isolate="MAV LMB1" FT /mol_type="genomic RNA" FT /country="New Zealand:Otago" FT /note="serogroup: MAV" FT /db_xref="taxon:2169984" FT CDS <1..80 FT /codon_start=3 FT /product="RNA-dependent RNA polymerase P2 fusion protein" FT /db_xref="GOA:B6RCI1" FT /db_xref="UniProtKB/TrEMBL:B6RCI1" FT /protein_id="ABR26534.1" FT /translation="SVKVTTPHLQSILLSIPENHSHNEY" FT CDS 194..>786 FT /codon_start=1 FT /product="coat protein P3" FT /note="ORF3; translated from subgenomic RNA1" FT /db_xref="GOA:B6RCI2" FT /db_xref="InterPro:IPR001517" FT /db_xref="InterPro:IPR029053" FT /db_xref="UniProtKB/TrEMBL:B6RCI2" FT /protein_id="ABR26535.1" FT /translation="MNLVGRRNNRRRNGPRRARRVSAVRRMVVVQPNRAGPKRRTRRRT FT RGGGANLISGPAGRTEVFVFSVNDLKANSSGTIKFGPDLSQCPALSGGILKSYHRYKIT FT NVKVEFKSHASANTVGAMFVELDTSCSQSTLGSYINSFTISKSATKTFTAQQIDGKEFR FT ESTVNQFYMLYKANGTTSDTAGQFIITIRVANMTP" FT CDS 231..695 FT /codon_start=1 FT /product="movement protein P4" FT /note="ORF4; translated via leaky scanning of subgenomic FT RNA1" FT /db_xref="InterPro:IPR001964" FT /db_xref="UniProtKB/TrEMBL:B6RCI3" FT /protein_id="ABR26536.1" FT /translation="MAQGEQGALAQFGEWLWSNPIEPDPNDELVDAQEEEGQILYLDQQ FT AGLRYSYSQSTTLRPTPQGQSSSVPTFRNAQRFQVEYSSPTTVTRSQTSRLSLSHTRPP FT IQSAQCLLNSTLRAHNQPWVATLTHSPSQNQQPKPSPPNRLTGRNSGRAR" XX SQ Sequence 786 BP; 239 A; 197 C; 171 G; 179 T; 0 other; agagtgtgaa ggtgactact ccacatctgc aatcaatact actttccata ccggaaaacc 60 actcacataa cgaatattaa ttatcaaatc ttagctgggt ttggaatagg gtttatagtt 120 tctataccct gtacattagc tctcacgtac tttatttaca ataaagtttc agacactact 180 agagaggtag tgaatgaatt tagtaggccg tagaaataac cgcaggagaa atggcccaag 240 gagagcaagg cgcgttagcg cagttcggag aatggttgtg gtccaaccca atcgagccgg 300 acccaaacga cgaactcgtc gacgcacaag aggaggaggg gcaaatctta tatctggacc 360 agcaggcagg actgaggtat tcgtattctc agtcaacgac cttaaggcca actcctcagg 420 gacaatcaag ttcggtcccg acctttcgca atgcccagcg ctttcaggtg gaatactcaa 480 gtcctaccac cgttacaaga tcacaaacgt caaggttgag tttaagtcac acgcgtccgc 540 caatacagtc ggcgcaatgt ttgttgaact cgacacttcg tgctcacaat caaccttggg 600 tagctacatt aactcattca ccatctcaaa atcagcaacc aaaaccttca ccgcccaaca 660 gattgacggg aaggaattca gggagagcac ggtgaaccaa ttttacatgc tatacaaggc 720 gaacggtact acgtcggaca ccgccgggca attcatcatc acaatacgcg ttgccaatat 780 gactcc 786 //