ID EF408157; SV 1; linear; genomic RNA; STD; VRL; 789 BP. XX AC EF408157; XX DT 31-OCT-2008 (Rel. 97, Created) DT 29-DEC-2008 (Rel. 98, Last updated, Version 2) XX DE Barley yellow dwarf virus-PAV isolate PAV on13-5 RNA-dependent RNA DE polymerase P2 fusion protein and coat protein P3 genes, partial cds; and DE movement protein P4 gene, complete cds. XX KW . XX OS Barley yellow dwarf virus PAV OC Viruses; Riboviria; Luteoviridae; Luteovirus. XX RN [1] RP 1-789 RA Delmiglio C., Pearson M.N.; RT "Sequence variation of barley yellow dwarf viruses from New Zealand RT grasses"; RL Unpublished. XX RN [2] RP 1-789 RA Delmiglio C., Pearson M.N.; RT ; RL Submitted (29-JAN-2007) to the INSDC. RL School of Biological Sciences, The University of Auckland, 3A Symonds St., RL Private Bag 92019, Auckland 1142, New Zealand XX DR MD5; 5ee5fa1dab0ef4aad086ba1cb2c70945. XX FH Key Location/Qualifiers FH FT source 1..789 FT /organism="Barley yellow dwarf virus PAV" FT /host="Microlaena stipoides" FT /isolate="PAV on13-5" FT /mol_type="genomic RNA" FT /country="New Zealand:Coromandel" FT /note="serogroup: PAV" FT /db_xref="taxon:2169986" FT CDS <1..80 FT /codon_start=3 FT /product="RNA-dependent RNA polymerase P2 fusion protein" FT /db_xref="GOA:B6RCB0" FT /db_xref="UniProtKB/TrEMBL:B6RCB0" FT /protein_id="ABR26463.1" FT /translation="SVKVTTPHLQSILLSIPENHSQNEY" FT CDS 194..>789 FT /codon_start=1 FT /product="coat protein P3" FT /note="ORF3; translated from subgenomic RNA1" FT /db_xref="GOA:B6RCB1" FT /db_xref="InterPro:IPR001517" FT /db_xref="InterPro:IPR029053" FT /db_xref="UniProtKB/TrEMBL:B6RCB1" FT /protein_id="ABR26464.1" FT /translation="MNSVGRRGPRRANQNGTRRRRRRTVRPVVVVQPNRAGLRRRNGRR FT KGRGGANPVFRPTGGAEVFVFSVDNLKANSTGTIKFGPSLSQCPALSDGILKSYHRYKI FT TSVRVEFKSHASATTAGAIFIELDTACKQSALASYINSFTISRTASKVFRAEAINGKEF FT QESTIDQFWMLYKANGTTADTAGQFIITMSVSLMTA" FT CDS 237..698 FT /codon_start=1 FT /product="movement protein P4" FT /note="ORF4; translated via leaky scanning of subgenomic FT RNA1" FT /db_xref="InterPro:IPR001964" FT /db_xref="UniProtKB/TrEMBL:B6RCB2" FT /protein_id="ABR26465.1" FT /translation="MAQEGGAVEQFGQWLWSNPIEQDSDDEMVDAREEEGQILYLDQQA FT GLRYSYSQSTTLKPTLPGQSNSAPVYRNAQRFQTEYLSPTTVTRSQVSVLSLSHTRPQL FT RPALSLLNSTPRANNQPWLATLIPSQSAGPRQRSSEPKRLTGRNSRNQR" XX SQ Sequence 789 BP; 237 A; 192 C; 186 G; 174 T; 0 other; agagtgtgaa ggtgacgact ccacatctgc aatcaatact gctttccata ccggaaaacc 60 actcacaaaa cgaatattaa ttatcaaatc ttagctgggt ttggaatagg gtttatagtt 120 agtataccct gtacattagc tctcacgtac tttatttaca ataaagtttc agacaccact 180 agagaggtgg tgaatgaatt cagtaggccg tagaggacct agacgcgcaa atcaaaatgg 240 cacaagaagg aggcgccgta gaacagttcg gccagtggtt gtggtccaac ccaatcgagc 300 aggactcaga cgacgaaatg gtcgacgcaa gggaagagga ggggcaaatc ctgtatttag 360 accaacaggc ggggctgagg tattcgtatt ctcagtcgac aaccttaaag ccaactctac 420 cgggacaatc aaattcggcc ccagtctatc gcaatgccca gcgctttcag acggaatact 480 taagtcctac caccgttaca agatcacaag tgtccgtgtt gagtttaagt cacacgcgtc 540 cgcaactacg gccggcgcta tctttattga actcgacacc gcgtgcaaac aatcagccct 600 ggctagctac attaattcct tcacaatcag caggaccgcg tcaaaggtct tcagagccga 660 agcgattaac gggaaggaat tccaggaatc aacgatagac cagttctgga tgctctacaa 720 ggccaatgga accaccgctg acacggcagg acaattcatt atcacgatga gtgtcagttt 780 gatgacggc 789 //