ID DQ415515; SV 1; linear; genomic RNA; STD; VRL; 660 BP. XX AC DQ415515; XX DT 27-MAR-2006 (Rel. 87, Created) DT 07-SEP-2010 (Rel. 106, Last updated, Version 2) XX DE Beet necrotic yellow vein virus isolate S-02 P25 protein gene, complete DE cds. XX KW . XX OS Beet necrotic yellow vein virus OC Viruses; Riboviria; Benyviridae; Benyvirus. XX RN [1] RP 1-660 RX DOI; 10.1094/PDIS-91-7-0847. RX AGRICOLA; IND44007680. RA Liu H.-Y., Lewellen R.T.; RT "Distribution and Molecular Characterization of Resistance-Breaking RT Isolates of Beet necrotic yellow vein virus in the United States"; RL Plant Dis. 91(7):847-851(2007). XX RN [2] RP 1-660 RA Liu H.-Y.; RT "Liu, H. Y., Sears, J. L., Lewellen, R. T. Distribution and molecular RT analysis of resistance-breaking isolates of Beet necrotic yellow vein virus RT in the United States"; RL Unpublished. XX RN [3] RP 1-660 RA Liu H.-Y.; RT ; RL Submitted (23-FEB-2006) to the INSDC. RL USDA-ARS, 1636 East Alisal Street, Salinas, California 93905, USA XX DR MD5; e9fc19bb9b2891dd13cec0ad0797fdf1. XX FH Key Location/Qualifiers FH FT source 1..660 FT /organism="Beet necrotic yellow vein virus" FT /isolate="S-02" FT /mol_type="genomic RNA" FT /db_xref="taxon:31721" FT CDS 1..660 FT /codon_start=1 FT /product="P25 protein" FT /db_xref="InterPro:IPR008419" FT /db_xref="UniProtKB/TrEMBL:Q66ZW7" FT /protein_id="ABD91568.1" FT /translation="MGDILGAVYDLGHRPYLARRTVYEDRLILSTHGNICRAINLLTHD FT NRTTLVYHNNTKRIRFRGLLCACHGPYCGFRALCRVMLCSLPRLCDIPINGSRDFVADP FT TRLDSSVNELLVSNGLVIHYDRVHHVPLHTDGFEVVDFTTVFRGPGNFLLPNATNFPRP FT TTTDQVYMVCLVNTVNCVLRFESELTVWVHSGLYTGDVLDVDNNVIQAPDGVDDDD" XX SQ Sequence 660 BP; 150 A; 125 C; 151 G; 234 T; 0 other; atgggtgata tattaggcgc agtttatgat ttagggcaca gaccttacct agcacggcgt 60 acggtttatg aggatcgttt gattcttagc acacatggta atatctgtcg ggctattaac 120 ttgttaactc acgataatcg tactacactg gtgtatcaca ataatactaa acgcataagg 180 tttcgtggat tattgtgtgc ttgtcatggg ccttattgtg ggtttcgtgc cttatgtaga 240 gtaatgttat gttctctacc tcgtttgtgt gacatcccta tcaatggatc tcgcgacttt 300 gttgcagatc ctaccagact cgacagctct gttaatgagt tgctggtttc taatggtctc 360 gtcatccact atgatcgtgt tcatcatgtt cccttacaca ctgatggttt tgaagttgta 420 gatttcacga ctgtctttcg tggtcctgga aactttcttt tgcctaatgc aacaaatttc 480 cctcggccaa ccacaaccga tcaggtttac atggtgtgtt tggtaaacac ggttaattgt 540 gtgttacgtt ttgagtccga acttacagtg tgggttcact ctggtttgta tacaggtgat 600 gttttagatg tggataataa tgttattcaa gcccctgacg gtgttgatga tgatgattag 660 //