ID DQ365829; SV 1; linear; genomic DNA; STD; VRL; 177 BP. XX AC DQ365829; XX DT 06-FEB-2006 (Rel. 86, Created) DT 06-FEB-2006 (Rel. 86, Last updated, Version 1) XX DE Tomato leaf curl virus isolate IARI AC4 protein gene, complete cds. XX KW . XX OS Tomato leaf curl virus OC Viruses; Geminiviridae; Begomovirus. XX RN [1] RP 1-177 RA Kumari P., Ramesh S.V., Praveen S.; RT "AC4 ORF of tomato leaf curl virus-IARI isolate- New Delhi"; RL Unpublished. XX RN [2] RP 1-177 RA Kumari P., Ramesh S.V., Praveen S.; RT ; RL Submitted (16-JAN-2006) to the INSDC. RL Division of Plant Pathology, Indian Agricultural Research Institute, Pusa, RL New Delhi 110012, India XX DR MD5; 982c9c1282327623bd7a1ee8316a47ed. XX FH Key Location/Qualifiers FH FT source 1..177 FT /organism="Tomato leaf curl virus" FT /isolate="IARI" FT /mol_type="genomic DNA" FT /country="India:New Delhi" FT /db_xref="taxon:28350" FT CDS 1..177 FT /codon_start=1 FT /product="AC4 protein" FT /db_xref="InterPro:IPR002488" FT /db_xref="UniProtKB/TrEMBL:Q2HY48" FT /protein_id="ABC88382.1" FT /translation="MGLRISMFSSNSKGNSSAKITDSSTWFPQVGQHISIRTFRELNQR FT QMSKHTSTKTETF" XX SQ Sequence 177 BP; 54 A; 44 C; 36 G; 43 T; 0 other; atgggtctcc gcatatccat gttctcatcc aattcgaagg gaaattccag tgcaaaaata 60 acagattctt cgacttggtt tccccaagtc ggtcagcaca tttccatccg aacattcagg 120 gagctaaatc agcgtcagat gtcaaagcat acatcgacaa agacggagac gttctag 177 //