ID DQ300178; SV 1; linear; genomic RNA; STD; VRL; 675 BP. XX AC DQ300178; XX DT 12-DEC-2005 (Rel. 86, Created) DT 12-DEC-2005 (Rel. 86, Last updated, Version 1) XX DE Prunus necrotic ringspot virus isolate Beijing coat protein (CP) gene, DE complete cds. XX KW . XX OS Prunus necrotic ringspot virus OC Viruses; Riboviria; Bromoviridae; Ilarvirus. XX RN [1] RP 1-675 RA Zhang Y.J., Li M.F., Huang C.; RT "CP gene for coat protein of Prunus necrotic ringspot infecting cherry in RT China"; RL Unpublished. XX RN [2] RP 1-675 RA Zhang Y.J., Li M.F., Huang C.; RT ; RL Submitted (21-NOV-2005) to the INSDC. RL Chinese Academy of Inspection and Quarantine, No. A3, Gaobeidian Beilu, RL Chaoyang District, Beijing, Beijing 100025, China XX DR MD5; a1cb2641bda760c5466e45c1b54fa557. XX FH Key Location/Qualifiers FH FT source 1..675 FT /organism="Prunus necrotic ringspot virus" FT /segment="RNA3" FT /isolate="Beijing" FT /mol_type="genomic RNA" FT /country="China" FT /db_xref="taxon:37733" FT gene 1..675 FT /gene="CP" FT CDS 1..675 FT /codon_start=1 FT /gene="CP" FT /product="coat protein" FT /note="capsid protein" FT /db_xref="GOA:Q2PW97" FT /db_xref="InterPro:IPR002681" FT /db_xref="UniProtKB/TrEMBL:Q2PW97" FT /protein_id="ABC02399.1" FT /translation="MVCRICNHTHAGGCRSCKKCHPNGALVPLRAQQRAANNPNRSPNR FT ASSGTGPVVRPQPVVKTTWTVRGPNVPPRIPKGFVAHNHREVTTTEAVKYLSIDFTTTL FT PQLMGQNLTLLTVIVRMNSMSSNGWIGMVEDYKVEQPDGPNALSRKGFLKDQPRGWQFE FT PPSDLDFDTFARTHRVVIEFKTEVPAGAKVLVRDLYVVVSDLPRVQIPIDVLLVDEDLL FT EI" XX SQ Sequence 675 BP; 163 A; 154 C; 194 G; 164 T; 0 other; atggtttgcc gaatttgcaa tcatacccac gctggtggat gccgttcttg caagaagtgc 60 catccgaatg gagctctggt cccactcagg gctcaacaga gggcagcgaa taacccgaat 120 agaagcccga atagggcttc gagtggtacc ggaccagtgg tccgaccaca gccggtcgtg 180 aagaccacct ggaccgtgag aggtccgaat gtgcctcccc gaattcctaa ggggtttgta 240 gcacacaatc accgagaggt gacgacgaca gaggcagtga agtacttgag tatagacttc 300 acgaccactc tccctcagtt gatgggtcag aatttgaccc tattgactgt tatagtccga 360 atgaactcta tgagttcgaa tggttggatt gggatggtgg aggactataa ggtggaacaa 420 cctgatggtc cgaatgccct gtccaggaag gggttcttga aggaccaacc gagaggttgg 480 cagttcgaac ctccttccga tttagatttc gacacttttg cgcgtacgca tcgtgtcgtt 540 atcgaattca agaccgaagt gcccgctggg gctaaggtct tggttaggga tttgtacgta 600 gtggtaagtg atttaccacg agtgcaaatt ccgattgatg tcttgctggt cgatgaggac 660 ctgcttgaga tctag 675 //