ID DQ285676; SV 1; linear; genomic RNA; STD; VRL; 603 BP. XX AC DQ285676; XX DT 30-NOV-2005 (Rel. 86, Created) DT 14-SEP-2006 (Rel. 89, Last updated, Version 3) XX DE Barley yellow dwarf virus - PAS WG13 coat protein (ORF3) gene, complete DE cds. XX KW . XX OS Barley yellow dwarf virus PAS OC Viruses; Riboviria; Luteoviridae; Luteovirus. XX RN [1] RP 1-603 RX DOI; 10.1099/vir.0.81834-0. RX PUBMED; 16963766. RA Hall G.; RT "Selective constraint and genetic differentiation in geographically distant RT barley yellow dwarf virus populations"; RL J. Gen. Virol. 87(Pt 10):3067-3075(2006). XX RN [2] RP 1-603 RA Hall G.S.; RT ; RL Submitted (08-NOV-2005) to the INSDC. RL Ecology and Evolutionary Biology, Cornell Univerisity, Tower Rd., Ithaca, RL NY 14853, USA XX DR MD5; 01a7e50834497757ff540605a92f00ab. XX FH Key Location/Qualifiers FH FT source 1..603 FT /organism="Barley yellow dwarf virus PAS" FT /isolate="WG13" FT /serotype="PAS" FT /mol_type="genomic RNA" FT /country="USA" FT /db_xref="taxon:2169985" FT gene 1..603 FT /gene="ORF3" FT CDS 1..603 FT /codon_start=1 FT /gene="ORF3" FT /product="coat protein" FT /note="viral capsid protein" FT /db_xref="GOA:Q2V8U0" FT /db_xref="InterPro:IPR001517" FT /db_xref="InterPro:IPR029053" FT /db_xref="UniProtKB/TrEMBL:Q2V8U0" FT /protein_id="ABB88868.1" FT /translation="MNSVGRRGPRRANQNGPRRRSRRTIRPVVVVQPNRAGPRRRNGRR FT SGRRGPNSIPGSTGRTEVFIFSVDNLKANSSGTIKFGPSLSQCPALSDGILKSYHRYKI FT TSIRVEFKSHASATTSGAIFVELDTACKQSALGSYINSFTISKTASKSFRAEAINGKEF FT QESTIDQFWLLYKANGTTTDTAGQFIIKINVSMLTPK" XX SQ Sequence 603 BP; 185 A; 157 C; 134 G; 127 T; 0 other; atgaattcag taggtcgtag aggacctaga cgagcaaatc aaaatggccc aagaaggcgg 60 agccgtagaa caattcggcc agtggttgtg gtccaaccca atcgagcagg acccagacga 120 cgaaatggtc gacgctcagg aagaagaggg ccaaattcta tacctggatc aacaggcagg 180 actgaggtat tcatattctc agtcgacaac cttaaagcca actcttccgg gacaatcaaa 240 ttcggtccca gtttatcgca atgcccagcg ctttcagacg gaatacttaa gtcctaccac 300 cgttacaaga tcacaagtat ccgtgttgag tttaagtcac acgcgtccgc cactacgtcg 360 ggcgctatct ttgttgaact cgacaccgcg tgcaagcaat cagccctggg tagctacatt 420 aattccttca ccatcagcaa aactgcctcc aagtccttca gagccgaggc gattaatggg 480 aaggaattcc aagaatcaac gatagaccaa ttctggctac tctacaaggc aaatgggacc 540 actactgaca ccgctggaca gttcatcata aaaataaacg tcagtatgtt aactcccaaa 600 tag 603 //