ID DQ248066; SV 1; linear; genomic RNA; STD; VRL; 819 BP. XX AC DQ248066; XX DT 31-DEC-2005 (Rel. 86, Created) DT 10-DEC-2009 (Rel. 103, Last updated, Version 2) XX DE Peruvian horse sickness virus segment 10, complete sequence. XX KW . XX OS Peruvian horse sickness virus OC Viruses; Riboviria; Reoviridae; Sedoreovirinae; Orbivirus. XX RN [1] RP 1-819 RX DOI; 10.1016/j.virol.2009.08.032. RX PUBMED; 19766284. RA Attoui H., Mendez-Lopez M.R., Rao S., Hurtado-Alendes A., RA Lizaraso-Caparo F., Jaafar F.M., Samuel A.R., Belhouchet M., RA Pritchard L.I., Melville L., Weir R.P., Hyatt A.D., Davis S.S., Lunt R., RA Calisher C.H., Tesh R.B., Fujita R., Mertens P.P.; RT "Peruvian horse sickness virus and Yunnan orbivirus, isolated from RT vertebrates and mosquitoes in Peru and Australia"; RL Virology 394(2):298-310(2009). XX RN [2] RP 1-819 RA Rao S., Rosario M., Tesh B., Hurtado A., Meyer A., Hice C., Pritchard L.I., RA Mertens P.P.C.; RT "Genome of Peruvian Horse Sickness Virus and Placement of the Virus as a RT New Species in the Genus Orbivirus of the Reoviridae Family"; RL Unpublished. XX RN [3] RP 1-819 RA Rao S., Rosario M., Tesh B., Hurtado A., Meyer A., Hice C., Pritchard L.I., RA Mertens P.P.C.; RT ; RL Submitted (17-OCT-2005) to the INSDC. RL Molecular Biology, Institute for Animal Health, BBSRC, Ash Road, Pirbright, RL Woking, Surrey GU24 0NF, UK XX DR MD5; f56f81fb0729ad0d5da7dc270e7bf7a4. XX FH Key Location/Qualifiers FH FT source 1..819 FT /organism="Peruvian horse sickness virus" FT /segment="10" FT /mol_type="genomic RNA" FT /country="Peru" FT /collection_date="1997" FT /db_xref="taxon:356862" FT CDS 13..780 FT /codon_start=1 FT /product="NS3" FT /db_xref="GOA:Q2Q1D5" FT /db_xref="InterPro:IPR002565" FT /db_xref="UniProtKB/TrEMBL:Q2Q1D5" FT /protein_id="ABB72779.1" FT /translation="MMHAALSMTKHENPISLLTVVPATAPRFDEITDLISSKGEKEEVK FT ITMSETMNAKTTALEVLSSALGNGSGTDEITRRERSAFGAATQALNEEENTRRLKVYMN FT EQILPKLKNKLMTVTYKYRIWLAVEIILAIFSMVVFGVMAVNEAESEINSWLQNKLGVK FT VGLSAVSLGCTFALLFASRSAGALKETVKRMKREITKRETYNHIAGTMAAGTERRVENS FT ESRVSNHLNAAWINAPGTTNDVPGWQLVRLKEG" XX SQ Sequence 819 BP; 292 A; 132 C; 203 G; 192 T; 0 other; gttaaaaatc tcatgatgca tgccgccctt tcaatgacga aacacgaaaa tcctatttct 60 ctactgacag ttgttcccgc gaccgcgccc cgatttgacg aaataacgga tttgatttcg 120 agtaaaggcg aaaaggaaga ggtgaaaatt acaatgtcag aaacaatgaa tgcaaagaca 180 acagcgttag aggtattgtc aagtgcatta ggaaacggaa gtggaacgga cgaaataact 240 agacgtgaga gaagtgcatt tggagcagca acacaagcat taaatgaaga agaaaacacc 300 agaaggctta aagtatatat gaacgaacag atattaccga aactgaaaaa taaattgatg 360 acggttacat ataagtatag gatatggttg gcagttgaaa ttatacttgc aatattttca 420 atggttgtat ttggagtaat ggcggtaaat gaggcggaaa gcgaaattaa ttcatggtta 480 cagaacaaat taggtgtaaa ggttggactc tcagcggtaa gtcttggttg tacattcgcg 540 ttgttgtttg caagccggag tgccggtgca ttaaaagaga cggttaaaag gatgaaacgt 600 gaaattacaa aaagggaaac atataaccat attgctggga cgatggctgc tggaaccgaa 660 agacgggtgg agaatagcga atcacgagta agtaatcatt tgaacgccgc atggatcaat 720 gcacctggca caaccaatga cgtacctggc tggcaactgg tacgtctcaa agaaggttaa 780 cgctgaatgt atgcaatatt cgcatgagat taaagatac 819 //