ID DQ002878; SV 1; linear; mRNA; STD; VRL; 796 BP. XX AC DQ002878; XX DT 03-MAY-2007 (Rel. 91, Created) DT 03-MAY-2007 (Rel. 91, Last updated, Version 1) XX DE Cucumber mosaic virus isolate DI2 coat protein (CP) mRNA, complete cds. XX KW . XX OS Cucumber mosaic virus (cucumber mosaic cucumovirus) OC Viruses; Riboviria; Bromoviridae; Cucumovirus. XX RN [1] RP 1-796 RA Sokhandan Bashir N., Nematallahi S.; RT "Detection, differentiation, and phylogenetic analysis of cucumber mosaic RT viruses isolated from cucurbits planted in the North West region of Iran"; RL Unpublished. XX RN [2] RP 1-796 RA Sokhandan Bashir N., Nematallahi S.; RT ; RL Submitted (08-APR-2005) to the INSDC. RL Plant Protection, University of Tabriz, 29 Bahman Blvd., Tabriz, E. Az. RL 51664, Iran XX DR MD5; 0d633a45b519b6543844c14091ceb047. XX FH Key Location/Qualifiers FH FT source 1..796 FT /organism="Cucumber mosaic virus" FT /host="squash" FT /isolate="DI2" FT /mol_type="mRNA" FT /country="Iran:Shendabad" FT /isolation_source="bristles on the fruit and leaf mosaic FT and narrowing" FT /clone="C2" FT /note="serogroup: I" FT /db_xref="taxon:12305" FT gene 1..796 FT /gene="CP" FT CDS 58..714 FT /codon_start=1 FT /gene="CP" FT /product="coat protein" FT /note="capsid protein" FT /db_xref="GOA:A5GXK5" FT /db_xref="InterPro:IPR000247" FT /db_xref="InterPro:IPR023800" FT /db_xref="InterPro:IPR037137" FT /db_xref="UniProtKB/TrEMBL:A5GXK5" FT /protein_id="AAY46232.1" FT /translation="MDKSESTSAGRNRRRRPRRGSRSAPSSADANFRVLSQQLSRLNKT FT LSAGRPTINHPTFVGSERCKPGYTFTSITLKPPKIDRGSYYGKRLLLPDSVTEYDKKLV FT SRIQIRVNPLPKFDSTVWVTVRKVPASSDLSVAAISAMFADGASPVLVYQYAASGVQAN FT NKLLYDLSAMRADIGDMRKYAVLVYSKDDALETDELVLHVHVEHQRIPTSGVLPV" XX SQ Sequence 796 BP; 180 A; 199 C; 187 G; 229 T; 1 other; atatagagag tgtgtgtgct gtgttttctc ttttgtgtcg tagaattgag tcgagtcatg 60 gacaaatctg aatcaaccag tgctggtcgc aaccgtcgac gtcgtccgcg tcgtggttcc 120 cgctccgccc cctcctccgc ggatgccaac tttagagtct tgtcgcagca gctttcgcga 180 cttaataaga cgttgtcagc tggtcgtcca actattaacc acccaacctt tgtagggagt 240 gagcgttgta aacctggata cacgttcaca tctattaccc taaagccacc aaaaatagac 300 cgtgggtctt attatggtaa aaggttgtta ttacctgatt cagtcacaga atatgataag 360 aagcttgttt cgcgcattca aattcgagtt aatcctttgc cgaaatttga ttctaccgtg 420 tgggtgacag tccgtaaagt tcctgcctcc tcggacttat ccgttgccgc catctctgct 480 atgtttgcgg acggagcctc accggtactg gtttatcagt atgctgcatc tggagttcaa 540 gctaacaaca aattgttgta tgatctttct gcgatgcgcg ctgatatagg cgacatgaga 600 aagtacgccg tcctcgtgta ctcaaaagac gatgcactcg agacggacga gctagtactt 660 catgttcacg tcgagcacca acgcattccc acgtctgggg tgctcccagt ataattctgt 720 gtttttccan aaccctccct ccgatttctg tggcgggagc tgagttggca gttctgctga 780 aactgtcgaa gtcact 796 //