ID DQ002877; SV 1; linear; mRNA; STD; VRL; 843 BP. XX AC DQ002877; XX DT 03-MAY-2007 (Rel. 91, Created) DT 03-MAY-2007 (Rel. 91, Last updated, Version 1) XX DE Cucumber mosaic virus isolate DI2 coat protein (CP) mRNA, complete cds. XX KW . XX OS Cucumber mosaic virus (cucumber mosaic cucumovirus) OC Viruses; Riboviria; Bromoviridae; Cucumovirus. XX RN [1] RP 1-843 RA Sokhandan Bashir N., Nematallahi S.; RT "Detection, differentiation, and phylogenetic analysis of cucumber mosaic RT viruses isolated from cucurbits planted in the North West region of Iran"; RL Unpublished. XX RN [2] RP 1-843 RA Sokhandan Bashir N., Nematallahi S.; RT ; RL Submitted (08-APR-2005) to the INSDC. RL Plant Protection, University of Tabriz, 29 Bahman Blvd., Tabriz, E. Az. RL 51664, Iran XX DR MD5; f210df0142ac984e8a0136a9d315bbff. XX FH Key Location/Qualifiers FH FT source 1..843 FT /organism="Cucumber mosaic virus" FT /host="squash" FT /isolate="DI2" FT /mol_type="mRNA" FT /country="Iran:Shendabad" FT /isolation_source="bristles on the fruit and leaf mosaic FT and narrowing" FT /clone="C1" FT /note="serogroup: I" FT /db_xref="taxon:12305" FT gene 1..843 FT /gene="CP" FT CDS 80..736 FT /codon_start=1 FT /gene="CP" FT /product="coat protein" FT /note="capsid protein" FT /db_xref="GOA:A5GXK5" FT /db_xref="InterPro:IPR000247" FT /db_xref="InterPro:IPR023800" FT /db_xref="InterPro:IPR037137" FT /db_xref="UniProtKB/TrEMBL:A5GXK5" FT /protein_id="AAY46231.1" FT /translation="MDKSESTSAGRNRRRRPRRGSRSAPSSADANFRVLSQQLSRLNKT FT LSAGRPTINHPTFVGSERCKPGYTFTSITLKPPKIDRGSYYGKRLLLPDSVTEYDKKLV FT SRIQIRVNPLPKFDSTVWVTVRKVPASSDLSVAAISAMFADGASPVLVYQYAASGVQAN FT NKLLYDLSAMRADIGDMRKYAVLVYSKDDALETDELVLHVHVEHQRIPTSGVLPV" XX SQ Sequence 843 BP; 190 A; 207 C; 199 G; 245 T; 2 other; attgcgttat tgtctactga ctatatagag agtgtgtgng ctgngttttc tcttttgtgt 60 cgtagaattg agtcgagtca tggacaaatc tgaatcaacc agtgctggtc gcaaccgtcg 120 acgtcgtccg cgtcgtggtt cccgctccgc cccctcctcc gcggatgcca actttagagt 180 cttgtcgcag cagctttcgc gacttaataa gacgttgtca gctggtcgtc caactattaa 240 ccacccaacc tttgtaggga gtgagcgttg taaacctgga tacacgttca catctattac 300 cctaaagcca ccaaaaatag accgtgggtc ttattatggt aaaaggttgt tattacctga 360 ttcagtcaca gaatatgata agaagcttgt ttcgcgcatt caaattcgag ttaatccttt 420 gccgaaattt gattctaccg tgtgggtgac agtccgtaaa gttcctgcct cctcggactt 480 atccgttgcc gccatctctg ctatgtttgc ggacggagcc tcaccggtac tggtttatca 540 gtatgctgca tctggagttc aagctaacaa caaattgttg tatgatcttt ctgcgatgcg 600 cgctgatata ggcgacatga gaaagtacgc cgtcctcgtg tactcaaaag acgatgcact 660 cgagacggac gagctagtac ttcatgttca cgtcgagcac caacgcattc ccacgtctgg 720 ggtgctccca gtataattct gtgtttttcc agaaccctcc ctccgatttc tgtggcggga 780 gctgagttgg cagttctgct gaaacctgtc tgaagtcact aaacgtttta cggtgaacgg 840 gtt 843 //