ID DQ000234; SV 1; linear; genomic RNA; STD; VRL; 699 BP. XX AC DQ000234; XX DT 15-MAY-2005 (Rel. 83, Created) DT 28-JUL-2005 (Rel. 84, Last updated, Version 2) XX DE Potato virus S isolate ordinary 12K protein gene, complete cds. XX KW . XX OS Potato virus S OC Viruses; Riboviria; Tymovirales; Betaflexiviridae; Quinvirinae; Carlavirus. XX RN [1] RP 1-699 RX DOI; 10.1016/j.jviromet.2005.04.009. RX PUBMED; 15927276. RA Bystricka D., Lenz O., Mraz I., Piherova L., Kmoch S., Sip M.; RT "Oligonucleotide-based microarray: a new improvement in microarray RT detection of plant viruses"; RL J. Virol. Methods 128(1-2):176-182(2005). XX RN [2] RP 1-699 RA Bystricka D., Lenz O., Mraz I., Piherova L., Kmoch S., Sip M.; RT ; RL Submitted (05-APR-2005) to the INSDC. RL Virology, Institute of Plant Molecular Biology (AVCR), Branisovska 31, RL Ceske Budejovice 38005, Czech Republic XX DR MD5; 9477fd01f062249598e6e5c4fcf5bba2. XX FH Key Location/Qualifiers FH FT source 1..699 FT /organism="Potato virus S" FT /isolate="ordinary" FT /mol_type="genomic RNA" FT /db_xref="taxon:12169" FT CDS 60..386 FT /codon_start=1 FT /product="12K protein" FT /db_xref="GOA:Q4U6U9" FT /db_xref="InterPro:IPR001896" FT /db_xref="UniProtKB/TrEMBL:Q4U6U9" FT /protein_id="AAY33745.1" FT /translation="MPLTPPPNYTGLYIAAALGVSLAAVVALFTRSTLPVVGDSQHNLP FT HGGRYRDGTKAIDYFKPAKLNSVEPGNHWYAQPWLLVLLLVALICLSGRHAPCCPRCNR FT VHSA" XX SQ Sequence 699 BP; 168 A; 183 C; 181 G; 167 T; 0 other; ggctgctgct tttccgtgct taacgaggca cactaagagc ttgctcatat tgtgccctga 60 tgccacttac accgccgcct aactacacag ggttatacat tgcagcggct ttaggagtgt 120 ctcttgccgc cgtagtggca ttgttcacta ggagtacact gccagttgtt ggggattcgc 180 agcacaacct cccacacggg ggacggtatc gcgacggtac taaagctatt gattacttca 240 aacctgcgaa actgaattct gttgagcctg gtaatcactg gtacgctcaa ccttggctgc 300 tagttctact tctagttgcg ctcatctgct tatcagggcg tcatgctcca tgctgtccaa 360 ggtgcaaccg agtgcacagt gcttaatggt tttcattttg gcattcgcgc taagttggta 420 tgtgctcagg ccaggaaaca caagctgcgt cctactcatc actggggaat cagtccggct 480 agtcaattgc gagctcacaa gagatttagt ggaagctgta gcaacattgg ggccgttgaa 540 gcacctttag gttcacaggt aagagttcga agaaactgtc ccacagagaa aatgccgccc 600 aaaccggatc cgacaagctc aggagagaca ccacaagcaa tgccgcttgt gccgccgccc 660 cggaatggag aggagcatag agtcggccca aatcaaggc 699 //