ID D10544; SV 1; linear; genomic RNA; STD; VRL; 657 BP. XX AC D10544; XX DT 23-JUN-1992 (Rel. 32, Created) DT 21-MAY-2003 (Rel. 75, Last updated, Version 3) XX DE Cucumber mosaic virus (CMV-FC) coat protein, complete cds. XX KW . XX OS Cucumber mosaic virus (cucumber mosaic cucumovirus) OC Viruses; Riboviria; Bromoviridae; Cucumovirus. XX RN [1] RP 1-657 RA Shintaku M.; RT ; RL Submitted (20-FEB-1992) to the INSDC. RL Michael Shintaku, Samuel Roberts Noble Foundation, Department of Molecular RL Virology; P.O. Box 2180, Ardmore, Oklahoma 73402, U.S.A. RL (E-mail:mshintaku@aardvark.ucs.uoknor.edu, Tel:405-223-5810, RL Fax:405-221-7380) XX RN [2] RP 1-657 RX PUBMED; 1919534. RA Shintaku M.; RT "Coat protein gene sequences of two cucumber mosaic virus strains reveal a RT single amino acid change correlating with chlorosis induction"; RL J. Gen. Virol. 72:2587-2589(1991). XX DR MD5; 13c7ccb59ab168d641610224b0c21925. DR EuropePMC; PMC112760; 10400773. XX FH Key Location/Qualifiers FH FT source 1..657 FT /organism="Cucumber mosaic virus" FT /strain="Fulton's C" FT /mol_type="genomic RNA" FT /db_xref="taxon:12305" FT CDS 1..657 FT /codon_start=1 FT /product="coat protein" FT /function="serine at amino acid 129 linked to chlorosis FT induction" FT /db_xref="GOA:Q00259" FT /db_xref="InterPro:IPR000247" FT /db_xref="InterPro:IPR023800" FT /db_xref="InterPro:IPR037137" FT /db_xref="UniProtKB/Swiss-Prot:Q00259" FT /protein_id="BAA01403.1" FT /translation="MDKSESTSAGRNRRRRPRRGSRSAPSSADANFRVLSQQLSRLNKT FT LAAGRPTINHPTFVGSERCRPGYTFTSITLKPPKIDRGSYYGKRLLLPDSVTEYDKKLV FT SRIQIRVNPLPKFDSTVWVTVRKVSASSDLSVAAISAMFADGASPVLVYQYAASGVQAN FT NKLLYDLSAMRADIGDMRKYAVLVYSKDDALETDELVLHVDIEHQRIPTSGVLPV" XX SQ Sequence 657 BP; 157 A; 170 C; 153 G; 177 T; 0 other; atggacaaat ctgaatcaac cagtgctggt cgtaaccgtc gacgtcgtcc gcgtcgtggt 60 tcccgctccg ctccctcctc cgcggatgct aactttagag tcttgtcgca gcagctttcg 120 cgacttaata agacgttagc agctggtcgt ccaactatta accacccaac ctttgtaggg 180 agtgaacgct gtagacctgg gtacacgttc acatctatta ccctaaagcc accaaaaata 240 gaccgtgggt cttattacgg taaaaggttg ttattacctg attcagtcac ggaatatgat 300 aagaagcttg tttcgcgcat tcaaattcga gttaatcctt tgccgaaatt tgattctacc 360 gtgtgggtga cagtccgtaa agtttctgcc tcctcggact tatccgttgc cgccatctct 420 gctatgttcg cggacggagc ctcaccggta ctggtttatc agtatgccgc atctggagtc 480 caagcaaaca acaaattgtt gtatgatctt tcggcgatgc gcgctgatat aggtgacatg 540 agaaagtacg ccgtcctcgt gtattcaaaa gacgatgcgc tcgagacgga cgagctagta 600 cttcatgttg acatcgagca ccaacgtatt cccacatctg gagtgctccc agtctga 657 //