ID D00535; SV 1; linear; genomic RNA; STD; VRL; 1157 BP. XX AC D00535; XX DT 19-JUL-1990 (Rel. 24, Created) DT 14-DEC-2007 (Rel. 94, Last updated, Version 7) XX DE Watermelon mosaic virus gene for polyprotein precursor, partial cds and DE 3'UTR. XX KW . XX OS Watermelon mosaic virus OC Viruses; Riboviria; Potyviridae; Potyvirus. XX RN [1] RP 43-1157 RX PUBMED; 2794980. RA Frenkel M.J., Ward C.W., Shukla D.D.; RT "The use of 3' non-coding nucleotide sequences in the taxonomy of RT potyviruses: Application to watermelon mosaic virus 2 and soybean mosaic RT virus-N"; RL J. Gen. Virol. 70:2775-2783(1989). XX RN [2] RP 1-42 RA Frenkel M.J.; RT "Watermelon mosaic virus 2 gene for polyprotein precursor, partial cds RT (coat protein region) and 3'UTR."; RL Unpublished. XX DR MD5; f5cd5577aaa00fb8bc6b9795e18df882. XX CC These data kindly submitted in computer readable form by: CC Maurice J. Frenkel CC CSIRO, Division of Biotechnology CC 343 Royal Parade, Parkville CC Victoria 3052 CC Australia CC The sequence is identical to that determined by direct protein CC sequencing (Yu et al., 1989). XX FH Key Location/Qualifiers FH FT source 1..1157 FT /organism="Watermelon mosaic virus" FT /mol_type="genomic RNA" FT /note="synonym: Watermelon mosaic virus 2" FT /db_xref="taxon:146500" FT CDS <1..909 FT /codon_start=1 FT /product="polyprotein precursor" FT /db_xref="GOA:P20235" FT /db_xref="InterPro:IPR001592" FT /db_xref="UniProtKB/Swiss-Prot:P20235" FT /protein_id="BAA00423.1" FT /translation="KYLEVLDFNHIDGCCESVSLQSGKEAVENLDTGKDSKKDTSGKGD FT KPQNSQTGQGSKEQTKIGTVSKDVNVGSKGKEVPRLQKITKKMNLPTVGGKIILSLDHL FT LEYKPNQVDLFNTRATKTEFESWYSAVKIEYDLNDEQMGVIMNGFMVWCIDNGTSPDVN FT GVWVMMDGEEQVEYPLKPIVENAKPTLRQIMHHFSDAAEAYIEMRNSESPYMPRYGLLR FT NLRDRELARYAFDFYEVTSKTPNRAREAIAQMKAAALAGINSRLFGLDGNISTNSENTE FT RHTARDVNQNMHTLLGMGPPQ" FT mat_peptide 64..909 FT /product="coat protein" FT /note="coat protein mature peptide" FT 3'UTR 910..1157 FT polyA_site 1157 XX SQ Sequence 1157 BP; 387 A; 189 C; 265 G; 316 T; 0 other; aaataccttg aagttttgga ttttaaccac attgacggtt gctgtgaatc agtgtctcta 60 caatcaggaa aagaagcagt agaaaatttg gatacaggga aggactcgaa gaaggacacc 120 agtggcaaag gggataaacc acaaaactcg caaactggcc aaggtagcaa agaacagaca 180 aaaattggca cagtcagcaa agatgtgaat gttggatcga aaggaaaaga agtcccacga 240 ttacaaaaga taacaaagaa aatgaacctt ccgacagttg gtgggaaaat cattcttagc 300 ttagaccatt tactcgagta caaacctaat caagttgatc tgtttaacac tcgagcaaca 360 aaaacagagt ttgaatcatg gtacagcgca gttaaaattg aatatgatct taacgatgag 420 caaatgggtg tgattatgaa tggttttatg gtttggtgta tcgataatgg tacatctcca 480 gatgtcaatg gagtttgggt gatgatggat ggagaagagc aagttgagta tccattaaag 540 ccaattgttg aaaatgcaaa accaactcta agacaaatca tgcaccattt ctcagacgca 600 gcagaagcat atattgaaat gagaaactct gaaagtccgt atatgcctag atacggatta 660 ctaagaaatt tgagagacag ggaattagca cgctatgctt ttgactttta tgaggttact 720 tccaaaacac ctaatagggc aagagaagca atagcacaaa tgaaggccgc agctctcgcg 780 ggaattaaca gcaggttatt tgggcttgat ggtaatatct cgaccaattc cgaaaatact 840 gagaggcaca ctgcaaggga cgtgaatcag aatatgcata ctttgttggg tatgggtccg 900 ccgcagtaaa gactaggtaa actggtcaca gttagcattt cgggtcgtta taagttttct 960 atattataat gtgttgcact tttagtatag tgtgatttta tcacctttat actttttatg 1020 ttagtgtggt ttaaccacct tagtgtgcct tatattatag tttatgcata acagggagaa 1080 ccattacaat accggagttg tttgtagtgt gattacatca cggttgatag ccgaggtacg 1140 gtaatgtttg ttgtcct 1157 //