ID D00490; SV 1; linear; genomic RNA; STD; VRL; 1015 BP. XX AC D00490; XX DT 11-APR-1990 (Rel. 23, Created) DT 30-JAN-2009 (Rel. 99, Last updated, Version 5) XX DE Bean yellow mosaic virus gene for polyprotein precursor (coat protein), DE partial cds. XX KW . XX OS Bean yellow mosaic virus OC Viruses; Riboviria; Potyviridae; Potyvirus. XX RN [1] RP 1-1015 RX PUBMED; 2671258. RA Hammond J., Hammond R.W.; RT "Molecular cloning, sequencing and expression in Escherichia coli of the RT bean yellow mosaic virus coat protein gene"; RL J. Gen. Virol. 70:1961-1974(1989). XX DR MD5; f8efac1464be3ebeb142f8b2ed26bc40. DR EuropePMC; PMC6449886; 30953486. XX CC The actual amino acid analyses of coat protein prepared from CC untreated and trypsin-treated virions are compared with the deduced CC amino acid composition. XX FH Key Location/Qualifiers FH FT source 1..1015 FT /organism="Bean yellow mosaic virus" FT /lab_host="Nicotiana benthamiana" FT /isolate="GDD" FT /mol_type="genomic RNA" FT /isolation_source="gladiolus" FT /clone="pBY6, pBY9" FT /db_xref="taxon:12197" FT CDS <1..849 FT /codon_start=1 FT /product="polyprotein precursor" FT /db_xref="GOA:P17765" FT /db_xref="InterPro:IPR001205" FT /db_xref="InterPro:IPR001456" FT /db_xref="InterPro:IPR001592" FT /db_xref="InterPro:IPR001650" FT /db_xref="InterPro:IPR001730" FT /db_xref="InterPro:IPR002540" FT /db_xref="InterPro:IPR007094" FT /db_xref="InterPro:IPR009003" FT /db_xref="InterPro:IPR011545" FT /db_xref="InterPro:IPR013648" FT /db_xref="InterPro:IPR014001" FT /db_xref="InterPro:IPR027417" FT /db_xref="InterPro:IPR031159" FT /db_xref="InterPro:IPR039560" FT /db_xref="InterPro:IPR042308" FT /db_xref="UniProtKB/Swiss-Prot:P17765" FT /protein_id="BAA00378.1" FT /translation="GEVLTCRFQSDQEQLNAGEEKKDKRKKNEGNPNKDSEGQSVRQIV FT PDRDVNAGTVGTFSVPRLKKIAGKLNIPKIGGKIVFNLDHLLKYNPPQDDISNVIATQA FT QFEAWYNGVKQAYEVEDSRMGIILNGLMVWCIENGTSGDLQGEWTMMDGEEQVTYPLKP FT ILDNAKPTFRQIMSHFSEVAEAYIEKRNATERYMPRYELQRNLTDYGLARYAFDFYELT FT SRTPVRAREAHMQMKAAAVRAKSTRLFGLDGNVGTDEENTERHTAGDVNRDMHTMLGVR FT I" FT mat_peptide 28..846 FT /product="coat protein" FT misc_feature 144 FT /note="predicted trypsin cleavage site" XX SQ Sequence 1015 BP; 336 A; 179 C; 248 G; 252 T; 0 other; ggtgaggtgc ttacgtgtcg ttttcaatca gatcaagagc aactcaatgc aggtgaggag 60 aagaaggata aaaggaaaaa gaatgaagga aatcctaata aggactctga ggggcagagt 120 gtcaggcaaa tagtaccaga cagagatgtg aatgcaggaa ctgttggaac attttcagtt 180 cctaggctca agaagatagc aggaaaacta aatattccca agattggtgg aaagattgtc 240 ttcaatttag accacttgct gaaatataac ccaccacagg atgacatttc aaatgtcata 300 gcaacacaag cacagtttga agcgtggtac aatggtgtca agcaagcata tgaggttgaa 360 gattcacgaa tgggaattat tttgaatggc cttatggtgt ggtgcataga aaatggcaca 420 tcaggagatt tacaaggtga atggacaatg atggatggag aagaacaggt gacataccct 480 ctaaaaccca tcttggacaa tgcaaagcca acattccgcc aaataatgtc gcatttctca 540 gaagttgcag aagcctacat tgaaaagagg aacgcaacag agaggtacat gccacggtat 600 gaacttcaaa ggaacttgac cgattatggt ttggctagat atgcttttga cttctacgaa 660 ctgacttcaa gaactcctgt gcgtgctaga gaagcacaca tgcaaatgaa ggcggcagca 720 gttagagcaa agtcaactag attatttgga cttgatggca atgttggaac agacgaggag 780 aacacagaga gacacacagc aggagatgtc aatcgtgata tgcacaccat gcttggtgtt 840 cgtatttaga gtatccgtct ttaaattctc tataatttgc gaacattact taataactag 900 attagtgagg ttcacctcca gcattttaaa ttcagtatgt gtatcattct ctcactcgat 960 cagggtaagc agttagtgag gttgcctcgt gtgagcctga tctttgtaga gcgag 1015 //