ID D00442; SV 1; linear; genomic RNA; STD; VRL; 1114 BP. XX AC D00442; XX DT 05-MAR-1991 (Rel. 27, Created) DT 07-JUL-2003 (Rel. 76, Last updated, Version 5) XX DE Grapevine fanleaf virus satellite RNA (RNA3), complete cds. XX KW . XX OS Grapevine fanleaf virus satellite RNA OC Viruses; Satellites; RNA satellites; Single stranded RNA satellites; OC Large single stranded RNA satellites. XX RN [1] RP 1-1114 RX PUBMED; 2471799. RA Fuchs M., Pinck M., Serghini M.A., Ravelonandro M., Walter B., Pinck L.; RT "The nucleotide sequence of satellite RNA in grapevine fanleaf virus, RT strain F13"; RL J. Gen. Virol. 70:955-962(1989). XX DR MD5; 30185a84016a55d365666d85f3bbc3da. XX CC The satellite RNA has a polyadenylated 3' end, and probably a CC protein (VPg) linked to the 5' terminus, and produces 39K protein CC in a wheatgerm translation system. Furthermore there is the weaker CC upper band. It may be readthrough product of 39K protein. XX FH Key Location/Qualifiers FH FT source 1..1114 FT /organism="Grapevine fanleaf virus satellite RNA" FT /mol_type="genomic RNA" FT /clone="pA4 and pA5" FT /note="5' end of satellite RNA." FT /note="satellite RNA (RNA3)" FT /db_xref="taxon:141860" FT misc_feature 3..10 FT /note="consensus sequence at the 5' end of nepovirus RNAs" FT CDS 15..1040 FT /codon_start=1 FT /note="39K product, P3" FT /db_xref="UniProtKB/Swiss-Prot:P17768" FT /protein_id="BAA00343.1" FT /translation="MDSYVTVDPSFHSPRISLEILVPTKYAKLFTLKQLSRMLALSCKH FT RARQAANPVSKRTSRDRNGSKTMGQGPSAVAPQVSKGHNQQVDGGVCLAPVKSKRAVRR FT EKRRTAAKKATNKAKTETKLVKKGGSSIHAPKAPKRTSYLSSLLSSPSGAKAKMGALSK FT PPQTKNAPDANEGGFTLTAITPAECRAEARRRFHPITGSSRGPYGFCTRSREGCGVCAD FT CVEKKAHLDFNRSFDTIGTSRVIRVDSMMEEVAEDLASPSVLEPSGFWAPAEKQAPSGE FT GHSRRRCDVVTLARVTPVLRMLRKVDPTLVDNRLLWEAAFRTVFPQRKCVYPHGCFCDR FT G" FT variation 720 FT /note="t in clone pA5; c in clone pA4" XX SQ Sequence 1114 BP; 246 A; 295 C; 313 G; 260 T; 0 other; tatgaaaaat ttctatggac tcttacgtta ccgtggatcc atcttttcac tctcccagaa 60 tctcacttga gattctggtc cctaccaagt atgcgaagct gtttaccctt aagcagctct 120 ctcgcatgct tgcattgtcg tgtaagcacc gtgcacggca agccgctaac ccggtaagca 180 aacggacctc ccgagaccga aatgggagta aaacaatggg tcagggtcct tctgctgtgg 240 ccccgcaagt gtcgaaggga cacaatcagc aagtagatgg aggggtttgt ctagccccgg 300 tgaagtcaaa gcgtgcggta cggcgtgaaa agcgccgtac tgccgctaag aaggccacta 360 ataaggccaa gaccgagacc aaactcgtta aaaagggtgg gtctagtatc cacgccccaa 420 aggcaccgaa gcggacgtcg tatttgtcta gtctgctttc gagtccttct ggggcgaaag 480 ccaaaatggg ggctctgagc aagccccccc aaacaaaaaa tgctcccgac gccaacgagg 540 gtggtttcac cctcactgct atcacaccgg ctgagtgccg ggcggaagct aggcgcagat 600 tccaccccat cacaggatcc tctcgtggtc cttatgggtt ctgcacccgc tcccgtgagg 660 gttgtggcgt gtgtgccgat tgtgtggaaa agaaggcaca cctggacttc aaccggagtt 720 ttgacactat tggcacttcg cgtgtcattc gtgtcgactc gatgatggaa gaagtggccg 780 aagacttggc cagccctagt gtcctagaac cctctgggtt ctgggctcct gctgaaaagc 840 aggctccttc tggagagggg cattcccgta gaaggtgcga cgtggtgaca ctcgcacgcg 900 taactccggt tctccggatg ttgcgtaagg tcgatcccac tcttgtggac aaccgacttt 960 tatgggaggc cgcgtttagg acggtctttc ctcagcgcaa gtgcgtgtat ccccacggtt 1020 gcttctgtga ccgtgggtag ggaagattgc agcgggacat cgtttgttta tagtctggcg 1080 taagctggga ttttggttgc tcattagcca actc 1114 //