ID D00298; SV 1; linear; genomic RNA; STD; VRL; 1232 BP. XX AC D00298; XX DT 11-APR-1990 (Rel. 23, Created) DT 17-APR-2005 (Rel. 83, Last updated, Version 4) XX DE Plum pox potyvirus gene for polyprotein, capsid protein region, partial DE cds. XX KW capsid protein; polyprotein. XX OS Plum pox virus OC Viruses; Riboviria; Potyviridae; Potyvirus. XX RN [1] RP 1-1232 RA Ravelonandro M., Varveri C., Delbos R., Dunez J.; RT "Nucleotide sequence of the capsid protein gene of plum pox potyvirus"; RL J. Gen. Virol. 69:1509-1516(1988). XX DR MD5; f9be375e585fa291693e2d4b01ecd8f8. XX CC The sequence of the 17 amino-terminal amino acids of the PPV capsid CC protein was determined chemically. They suggest that the PPV capsid CC protein is a product of the maturation of a large polyprotein, and CC the putative cleavage site is at a glutamine-alanine dipeptide. XX FH Key Location/Qualifiers FH FT source 1..1232 FT /organism="Plum pox virus" FT /strain="D" FT /mol_type="genomic RNA" FT /clone="pSE508" FT /note="85 bp upstream of HpaII site" FT /db_xref="taxon:12211" FT CDS <1..1017 FT /codon_start=1 FT /product="polyprotein" FT /db_xref="GOA:P13529" FT /db_xref="InterPro:IPR001205" FT /db_xref="InterPro:IPR001456" FT /db_xref="InterPro:IPR001592" FT /db_xref="InterPro:IPR001650" FT /db_xref="InterPro:IPR001730" FT /db_xref="InterPro:IPR002540" FT /db_xref="InterPro:IPR007094" FT /db_xref="InterPro:IPR009003" FT /db_xref="InterPro:IPR011492" FT /db_xref="InterPro:IPR013648" FT /db_xref="InterPro:IPR014001" FT /db_xref="InterPro:IPR027417" FT /db_xref="InterPro:IPR031159" FT /db_xref="InterPro:IPR039560" FT /db_xref="InterPro:IPR042308" FT /db_xref="UniProtKB/Swiss-Prot:P13529" FT /protein_id="BAA00210.1" FT /translation="VQTLLWHQADEREDEEEVDAGKPIVVTAPAATSPILQPPPVIQPA FT PRTTAPMLNPIFTPATTQPATKPVSQVPGPQLQTFGTYGNEDASPSNSNALVNTNRDRD FT VDAGSIGTFTVPRLKAMTSKLSLPKVKGKAIMNLNHLAHYSPAQVDLSNTRAPQSCFQT FT WYEGVKRDYDVTDDEMSIILNGLMVWCIENGTSPNINGMWVMMDGETQVEHPIKPLLDH FT AKPTFRRIVARFSDVAEACVEKRNYEKAYMPRYGIQRNLTDYSLARYAFDFYEMTSTTP FT VRAREAHIQMKAAALRNVQNRLFGLDGNVGTQKQDTERHTDGDVNRNMHTFLGVRGV" FT mat_peptide 25..1014 FT /product="capsid protein" FT polyA_site 1232 XX SQ Sequence 1232 BP; 362 A; 275 C; 295 G; 300 T; 0 other; gtccagacgt tgttgtggca ccaagctgac gaaagagagg acgaggagga agttgatgca 60 ggcaagccga ttgtagttac tgcaccggca gcaactagcc caatacttca accacctcca 120 gtcatacagc ctgcaccccg gactacggcg ccaatgctca accccatttt cacgccagca 180 acaactcaac cagcaacaaa accagtttca caggtgccag gacctcaact gcaaactttt 240 ggaacatatg gtaatgagga tgcatcacct agcaactcaa acgcgctagt caacacaaac 300 agagacaggg acgtcgatgc aggatcaatt ggaactttta cagtgccacg tttgaaggca 360 atgacttcga aactatctct gccaaaggtg aagggaaagg ctattatgaa cttgaaccat 420 ttggcacatt atagtcctgc acaggttgac ttgtcaaaca cgagagctcc gcagtcttgt 480 ttccaaactt ggtatgaagg agttaagcga gattatgatg tcacggacga tgaaatgagc 540 atcattttaa atggtcttat ggtttggtgc atagagaatg gaacatcccc gaatatcaat 600 ggaatgtggg tgatgatgga tggggaaaca caagtggagc atccaataaa gccattgttg 660 gatcatgcga aacccacttt tagacgaatt gtggcacgtt tcagcgacgt ggccgaagcg 720 tgtgtggaaa aacgaaatta cgaaaaagca tacatgccaa ggtatggaat tcagcgcaac 780 ctgacagact acagcctcgc cagatatgcc tttgattttt acgaaatgac ttcaacgaca 840 cccgtacggg cacgtgaagc tcatatccag atgaaggcag cagcattgag aaatgttcaa 900 aatcgtttat ttggcttgga tggaaacgtc ggaacacaga agcaggacac agagagacac 960 acggatggtg atgttaatcg caacatgcac accttcctcg gtgtgagggg agtgtagtgg 1020 tctcggtatc tatcataaac tctacctggt gagagtctaa tcatccagtt gttttagatt 1080 cctgttagca tccttttctc cgctttaata gcagtacatt cagtgaggtt ttacctccat 1140 atgttctagt ctgttattgt cgaacacagg cccttgtatc tgatgtagcg agtgctccac 1200 ttcattcggg ttatagttct tgtgcaagag ac 1232 //