ID D00240; SV 1; linear; genomic RNA; STD; VRL; 900 BP. XX AC D00240; XX DT 11-APR-1990 (Rel. 23, Created) DT 10-JUL-2007 (Rel. 92, Last updated, Version 10) XX DE Papaya mosaic virus genes for capsid protein, hypothetical protein, DE complete cds. XX KW . XX OS Papaya mosaic virus OC Viruses; Riboviria; Tymovirales; Alphaflexiviridae; Potexvirus. XX RN [1] RP 1-900 RX PUBMED; 3335832. RA Abouhaidar M.G.; RT "Nucleotide sequence of the capsid protein gene and 3' non-coding region of RT papaya mosaic virus RNA"; RL J. Gen. Virol. 69:219-226(1988). XX DR MD5; b6c23840aa33e32e390804d5e81b6e5b. DR EuropePMC; PMC4213569; 25337891. XX CC The amino acid sequence of the capsid protein obtained from the CC nucleotide sequence () and that CC of the direct amino acid sequence (Short et al.) differed in three CC amino acids. Gln was replaced by Glu (position 685), Thr by Ala CC (position 700) and Glu by Gln (position 775). The capsid protein CC was mapped to the 3' end of the viral genome, and in the CC complementary region a long open reading frame was also found. XX FH Key Location/Qualifiers FH FT source 1..900 FT /organism="Papaya mosaic virus" FT /mol_type="genomic RNA" FT /clone="A88, A99" FT /note="202 bp upstream of SacI site" FT /note="synonym: Papaya mosaic potexvirus" FT /db_xref="taxon:12181" FT CDS 136..780 FT /codon_start=1 FT /product="capsid protein" FT /db_xref="GOA:P16596" FT /db_xref="InterPro:IPR000052" FT /db_xref="PDB:4DOX" FT /db_xref="UniProtKB/Swiss-Prot:P16596" FT /protein_id="BAA00169.1" FT /translation="MSKSSMSTPNTAFPAITQEQMSSIKVDPTSNLLPSQEQLKSVSTL FT MVAAKVPAASVTTVALELVNFCYDNGSSAYTVTGPSSIPEISLAQLASIVKASGTSLRK FT FCRYFAPIIWNLRTDKMAPANWEASGYKPSAKFAAFDFFDGVENPAAMQPPSGLIRSPT FT QEERIANATNKQVHLFQAAAQDNNFTSNSAFITKGQISGSTPTIQFLPPPE" FT CDS complement(336..755) FT /codon_start=1 FT /product="hypothetical protein" FT /note="putative ORF" FT /db_xref="UniProtKB/Swiss-Prot:P16597" FT /protein_id="BAA00170.1" FT /translation="MVGVDPEIWPLVMKAELLVKLLSCAAAWKRCTCLLVALAIRSSWV FT GDLISPEGGCMAAGFSTPSKKSNAANLALGLYPEASQLAGAILSVLRFQIIGAKYRQNF FT LREVPEALTILANCASDISGIDDGPVTVYALDPLS" FT polyA_site 900 XX SQ Sequence 900 BP; 240 A; 253 C; 189 G; 218 T; 0 other; tgaactcaca ggacatagtg ctgttctaag aggaaataac tgtgagagct taacaccagg 60 tgttatagag gccctatccg cccacctaca cgggcttagg aactagcttc attcgaaatt 120 caaaattctg ttttaatgtc taagtcaagt atgtccacac ccaacacagc cttccccgcc 180 atcacccagg aacaaatgag ctcgattaag gtcgatccaa cgtccaatct cttgccctcc 240 caagagcagt taaagtcagt gtccaccctc atggtagctg ctaaggttcc agcagccagt 300 gtcacaactg tggcattgga gttggttaac ttctgctatg acaatgggtc cagcgcgtac 360 acagtgactg gcccatcatc aataccggag atatcactgg cacaattggc tagtattgtc 420 aaagcttccg gcacttccct tagaaaattc tgccggtact tcgcgccaat aatctggaat 480 ctgaggacgg acaaaatggc tcctgccaat tgggaggctt caggatacaa gccaagcgcc 540 aaatttgccg cgttcgactt cttcgacggg gtggagaatc cggcggccat gcaaccccct 600 tcgggactaa tcaggtcgcc gacccaggaa gagcggattg ccaatgctac caacaaacag 660 gtgcatctct tccaagccgc ggcacaggac aacaacttta ccagcaactc cgccttcatc 720 accaaaggcc aaatttctgg gtcaacccca accatccaat tccttccacc ccccgaataa 780 acacacttga cccagcccgt tgtttagcac tatttgttgg ggctattgag ttttcaaaat 840 gtgcttttgc tatagtagac gaaacttact acctagtttg gttttgcaaa tttcctttcc 900 //