ID AY965891; SV 1; linear; genomic RNA; STD; VRL; 549 BP. XX AC AY965891; XX DT 11-APR-2005 (Rel. 83, Created) DT 11-APR-2005 (Rel. 83, Last updated, Version 1) XX DE Cucumber mosaic virus isolate Guangdong 2b protein (2b) gene, complete cds. XX KW . XX OS Cucumber mosaic virus (cucumber mosaic cucumovirus) OC Viruses; Riboviria; Bromoviridae; Cucumovirus. XX RN [1] RP 1-549 RA Xu D.L., Zhou G.H., Song X.B.; RT "Sequencing of CP and 2b gene of CMV infecting pepper from Guangdong RT province"; RL Unpublished. XX RN [2] RP 1-549 RA Xu D.L., Zhou G.H., Song X.B.; RT ; RL Submitted (17-MAR-2005) to the INSDC. RL Plant Pathology, South China Agricultural University, Wushan, Guangzhou, RL Guangdong 510642, China XX DR MD5; 0d403a776f7bd1a9a223472215c1e960. XX FH Key Location/Qualifiers FH FT source 1..549 FT /organism="Cucumber mosaic virus" FT /host="pepper" FT /isolate="Guangdong" FT /serotype="I" FT /mol_type="genomic RNA" FT /country="China" FT /db_xref="taxon:12305" FT gene 96..431 FT /gene="2b" FT CDS 96..431 FT /codon_start=1 FT /gene="2b" FT /product="2b protein" FT /note="RNA silencing suppressor" FT /db_xref="InterPro:IPR004946" FT /db_xref="UniProtKB/TrEMBL:Q56D02" FT /protein_id="AAX78391.1" FT /translation="MELNAGAMTNVELQLARMVEVKRQRRRSHKRSRRERCYKSPSERA FT RSNLRLFRFLPFYQVDGMELIEMYRRVNVAELSEPEAPCFTLPAEDDHDFDDTDWFAGN FT EWAEGAF" XX SQ Sequence 549 BP; 141 A; 117 C; 158 G; 133 T; 0 other; ttcagatcgt cgtcagagcg aattgatcaa ttcgtttagt tgtgttgagt tgaggattga 60 gcgttcgagt ttcactaaac agcgaaagaa gaaagatgga attgaacgca ggcgcaatga 120 caaacgtcga actccaacta gcccgtatgg tggaggtgaa gagacagaga cgaaggtctc 180 acaagaggag tcgacgggaa cgatgttaca aaagtcccag cgagagggcg cgctcaaatc 240 tcaggctgtt ccgcttttta ccgttctatc aagtagatgg tatggaactg atagagatgt 300 accgccgcgt gaacgtggcg gaattgtccg agcccgaggc cccttgtttt acgttaccag 360 cggaagacga ccatgatttc gacgacacag actggttcgc tggtaatgag tgggcggaag 420 gtgcgttttg aacccctttc ctttctccct ccggttttct gaggcgggag cggagttggc 480 agtattgcta caaactgact gaagtctact aaagttttta cggtgaacgg gttgtccatc 540 cagctaacg 549 //