ID AY529714; SV 1; linear; genomic RNA; STD; VRL; 741 BP. XX AC AY529714; XX DT 04-MAR-2004 (Rel. 79, Created) DT 04-MAR-2004 (Rel. 79, Last updated, Version 1) XX DE Peanut yellow spot virus nucleocapsid protein gene, complete cds. XX KW . XX OS Peanut yellow spot virus OC Viruses; Riboviria; Negarnaviricota; Polyploviricotina; Ellioviricetes; OC Bunyavirales; Tospoviridae; Orthotospovirus. XX RN [1] RP 1-741 RA Ravi K.S., Bhanupriya M.; RT "Nucleotide diversity of Tospoviruses infecting economically important RT crops in India"; RL Unpublished. XX RN [2] RP 1-741 RA Ravi K.S., Bhanupriya M.; RT ; RL Submitted (19-JAN-2004) to the INSDC. RL Molecular Virology, Mahyco Life Sciences Research Center, Jalna-Aurangabad RL Road, Dawalwadi, Jalna, Maharashtra 431 203, India XX DR MD5; ef4dabda3cf831e473775f1f82059485. XX FH Key Location/Qualifiers FH FT source 1..741 FT /organism="Peanut yellow spot virus" FT /host="groundnut (Arachis hypogaea L.)" FT /mol_type="genomic RNA" FT /country="India:Jalna, Maharashtra" FT /db_xref="taxon:63443" FT CDS 1..741 FT /codon_start=1 FT /product="nucleocapsid protein" FT /db_xref="GOA:Q6QQQ2" FT /db_xref="InterPro:IPR002517" FT /db_xref="UniProtKB/TrEMBL:Q6QQQ2" FT /protein_id="AAS46337.1" FT /translation="MSTKGVVKVKNDRELFESLSKNAKVELEQEQISFTFKTFFDNKSS FT KVDLTEANMVLYINSANRLKLIGKENNAKVFLNINIVKSSPGVEEFTWSRLDSVIRMKY FT IDRIKDYNEDKLKAESAKLNNWLLEIFNLKQMSPKDEVIFKVITGGNLNHLMCFKTTFA FT HAFAIANYQHKRAEQLGITNFDTKAQLDRMIVIGERNGVLPSTAPLTLINQYFKNAMPR FT VKTAERDQSSKYEELQAAIGSGEL" XX SQ Sequence 741 BP; 250 A; 129 C; 167 G; 195 T; 0 other; atgtcgacaa aaggcgtggt aaaggtaaag aatgacagag aactctttga atctctttcc 60 aaaaatgcta aagttgagct tgagcaagag cagatatctt tcacttttaa gactttcttc 120 gataacaaaa gctctaaagt tgacttgact gaggccaata tggtgcttta catcaatagt 180 gccaatagat tgaagctcat cggtaaggaa aacaatgcca aggtgttctt gaatataaat 240 attgtgaaaa gctcaccagg cgtagaggag tttacttgga gcaggttgga ttctgtgata 300 aggatgaaat atattgacag aatcaaggat tacaatgagg ataagctgaa agctgaaagc 360 gcaaaattga ataactggct tttggagatt ttcaacttga aacagatgtc accaaaagat 420 gaggttatct tcaaagtcat aactggtggc aatctgaacc atctgatgtg tttcaaaaca 480 acttttgcgc atgcctttgc aattgcaaat tatcagcaca aaagagctga gcagcttggt 540 atcacaaact ttgatactaa ggctcagctt gacagaatga tagtgatagg cgaacgcaat 600 ggtgttttgc catcaactgc cccactgact ttgatcaatc agtatttcaa aaatgccatg 660 ccgagagtca agactgccga aagggatcag tcttccaaat atgaagagct tcaggcagct 720 ataggcagcg gagagctgtg a 741 //