ID AY387815; SV 1; linear; genomic RNA; STD; VRL; 909 BP. XX AC AY387815; XX DT 09-OCT-2003 (Rel. 77, Created) DT 13-AUG-2004 (Rel. 80, Last updated, Version 2) XX DE Johnsongrass mosaic virus isolate Sha2001Q coat protein gene, partial cds. XX KW . XX OS Johnsongrass mosaic virus OC Viruses; Riboviria; Potyviridae; Potyvirus. XX RN [1] RP 1-909 RX DOI; 10.1007/s00705-004-0316-9. RX PUBMED; 15290386. RA Laidlaw H.K., Persley D.M., Pallaghy C.K., Godwin I.D.; RT "Sequence diversity in the coat protein coding region of the genome RNA of RT Johnsongrass mosaic virus in Australia"; RL Arch. Virol. 149(8):1633-1641(2004). XX RN [2] RP 1-909 RA Laidlaw H.K.C., Persley D.M., Pallaghy C.K., Godwin I.D.; RT ; RL Submitted (11-SEP-2003) to the INSDC. RL School of Land and Food Sciences, The University of Queensland, St Lucia RL Campus, Brisbane, Queensland 4072, Australia XX DR MD5; 6c59cb4efd16bed23e45de3f68df3592. XX FH Key Location/Qualifiers FH FT source 1..909 FT /organism="Johnsongrass mosaic virus" FT /isolate="Sha2001Q" FT /mol_type="genomic RNA" FT /db_xref="taxon:31742" FT CDS <1..>909 FT /codon_start=1 FT /product="coat protein" FT /db_xref="GOA:Q6TTS4" FT /db_xref="InterPro:IPR001592" FT /db_xref="UniProtKB/TrEMBL:Q6TTS4" FT /protein_id="AAQ91079.1" FT /translation="SGNEDAGKQKSATPTANQTASGDGKTTQTTATAENKSSSDNTSNT FT QGTSQTKGDGESGGTNATAAKKDKDVDVGSTGTFVIPKLKKVSPKMRLPMVSNKAILNL FT DHLIQYKPDQRDISNARATHTQFQFWYNRIKKEYDVDDEQMRILMNGLMVWCIENGTSP FT DINGYWTMVDGNNQSEFPLKPIVENAKPTLRQCMMHFSDAAEAYIEMRNLDEPYMPRYG FT LLRNLNDKSLARYAFDFYEINSRTPNRAREAHAQMKAAAIRGSTNHMFGLDGNVGESSE FT NTERHTAADVSRNVHSYRGAKI" XX SQ Sequence 909 BP; 323 A; 178 C; 214 G; 194 T; 0 other; tcaggcaatg aggatgctgg gaaacagaag agtgcaacac caactgcaaa tcaaacagca 60 agtggggatg gtaaaacaac acaaacgaca gcgacagcag aaaacaagtc atcttcagat 120 aacacttcaa acactcaagg tacttcacag accaaaggag atggcgaatc gggtggaacg 180 aatgctacag cagcaaagaa ggataaggat gttgacgttg gatcaactgg aacttttgtt 240 attccgaaat taaagaaggt ttcacccaag atgcgtctac ctatggtgag caacaaagcc 300 atactcaatt tggaccatct aatccaatac aaaccagatc agagggacat ttcaaatgca 360 cgagctacac acacacaatt ccagttttgg tacaacagaa ttaagaaaga gtatgatgtt 420 gatgatgagc aaatgagaat tttgatgaat ggattgatgg tttggtgtat agagaatggc 480 acatcccctg atataaatgg ttattggacc atggtagatg ggaacaatca atcagagttt 540 ccactaaaac caatagtgga aaacgcaaaa ccaacattac gacagtgcat gatgcatttt 600 agtgatgccg cagaagcata cattgaaatg agaaatttgg atgagccgta catgccaaga 660 tacggtctcc ttaggaatct aaatgacaag agcctcgctc gatacgcatt tgatttctat 720 gagatcaatt cgcgcacacc aaatagagcg agagaggcac atgcacaaat gaaggcagca 780 gcaattagag ggtccacgaa tcacatgttt ggactcgacg ggaatgttgg agagagctct 840 gagaacacag agcggcacac agctgcagat gtttcacgga atgttcattc gtaccgtggg 900 gccaaaatc 909 //