ID AY377428; SV 1; linear; genomic RNA; STD; VRL; 822 BP. XX AC AY377428; XX DT 01-OCT-2003 (Rel. 77, Created) DT 01-OCT-2003 (Rel. 77, Last updated, Version 1) XX DE Iris yellow spot virus nucleocapsid protein (N) gene, complete cds. XX KW . XX OS Iris yellow spot virus OC Viruses; Riboviria; Negarnaviricota; Polyploviricotina; Ellioviricetes; OC Bunyavirales; Tospoviridae; Orthotospovirus. XX RN [1] RP 1-822 RA Mavric I., Ravnikar M.; RT "Characterisation of Iris yellow spot virus isolated from leek in RT Slovenia"; RL Unpublished. XX RN [2] RP 1-822 RA Mavric I., Ravnikar M.; RT ; RL Submitted (01-SEP-2003) to the INSDC. RL Department of plant physiology and biotechnology, National Institute of RL Biology, Vecna pot 111, Ljubljana SI-1000, Slovenia XX DR MD5; 8d6f321c51a54274b25a3382118a2302. XX FH Key Location/Qualifiers FH FT source 1..822 FT /organism="Iris yellow spot virus" FT /segment="S" FT /host="leek" FT /mol_type="genomic RNA" FT /country="Slovenia" FT /db_xref="taxon:60456" FT gene 1..822 FT /gene="N" FT CDS 1..822 FT /codon_start=1 FT /gene="N" FT /product="nucleocapsid protein" FT /note="N protein" FT /db_xref="GOA:Q6U700" FT /db_xref="InterPro:IPR002517" FT /db_xref="UniProtKB/TrEMBL:Q6U700" FT /protein_id="AAQ83585.1" FT /translation="MATVRVKKDEIERLLAGGDADVVIESDETAGFNFRNFIMANEDLR FT MTFNNGYTILRNRAGIYKSIKTGKFTFQGKPIIIPSANVNPGQDDWTFRRLEGFIRAGM FT LAELLETKNENDKQKMYEKLCGLPLVSAYGLKLSDKFDATTARIMLTLGGPLTLLPSLD FT SFSVAALPLAYFQNVKKESLGISKFSTYEQLCKVARVMAAKDFKFNEKYKKIFDETVKI FT LSECTPGTSGAASLVKFNEQIKILEGAFGKIVEDIGESSKPKNPSKKDRYN" XX SQ Sequence 822 BP; 278 A; 150 C; 173 G; 221 T; 0 other; atggctaccg ttagggtgaa aaaagatgaa atcgagaggc ttcttgccgg aggggatgca 60 gatgtggtaa ttgagtctga tgaaactgca ggattcaatt tcagaaactt cataatggca 120 aatgaagatc tccggatgac attcaataac ggttatacaa ttcttagaaa cagagctggc 180 atttacaaat caataaaaac aggcaaattc acattccaag gcaaacctat catcattccc 240 agtgcaaatg tgaaccccgg tcaagatgac tggacattca gaaggttgga aggttttatc 300 agagccggaa tgctcgcaga acttcttgaa acaaagaacg aaaatgacaa acagaaaatg 360 tatgaaaaac tatgcgggct tcctctggtg agtgcatatg gtctaaaact tagcgataaa 420 tttgatgcaa ctacagccag gatcatgctg acactgggcg gtcctctcac cttactgccg 480 agtcttgaca gcttttctgt agctgctctt cctttggctt attttcaaaa tgtgaaaaaa 540 gaatcacttg gcataagcaa attctcaact tatgagcaac tttgcaaagt tgcaagagtt 600 atggcagcaa aagattttaa attcaatgag aaatacaaga aaatctttga tgaaactgtc 660 aagattctct ctgaatgcac tcctggaact tctggtgctg cttcactggt caagttcaat 720 gaacagatta aaattcttga aggtgctttt ggaaagattg ttgaagacat tggtgagtct 780 tctaagccaa agaatccttc caagaaagat agatataatt aa 822 //